data_2E8O # _entry.id 2E8O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E8O pdb_00002e8o 10.2210/pdb2e8o/pdb RCSB RCSB026364 ? ? WWPDB D_1000026364 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022401.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E8O _pdbx_database_status.recvd_initial_deposition_date 2007-01-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goroncy, A.K.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title ;Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5) ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goroncy, A.K.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _cell.entry_id 2E8O _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2E8O _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SAM domain and HD domain-containing protein 1' _entity.formula_weight 11400.840 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dendritic cell-derived IFNG-induced protein, DCIP, Monocyte protein 5, MOP-5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLG ERKKLLSYIQRLVQIHVDTMKVI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLG ERKKLLSYIQRLVQIHVDTMKVI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022401.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 ASN n 1 10 THR n 1 11 PRO n 1 12 SER n 1 13 ALA n 1 14 GLU n 1 15 ALA n 1 16 ASP n 1 17 TRP n 1 18 SER n 1 19 PRO n 1 20 GLY n 1 21 LEU n 1 22 GLU n 1 23 LEU n 1 24 HIS n 1 25 PRO n 1 26 ASP n 1 27 TYR n 1 28 LYS n 1 29 THR n 1 30 TRP n 1 31 GLY n 1 32 PRO n 1 33 GLU n 1 34 GLN n 1 35 VAL n 1 36 CYS n 1 37 SER n 1 38 PHE n 1 39 LEU n 1 40 ARG n 1 41 ARG n 1 42 GLY n 1 43 GLY n 1 44 PHE n 1 45 GLU n 1 46 GLU n 1 47 PRO n 1 48 VAL n 1 49 LEU n 1 50 LEU n 1 51 LYS n 1 52 ASN n 1 53 ILE n 1 54 ARG n 1 55 GLU n 1 56 ASN n 1 57 GLU n 1 58 ILE n 1 59 THR n 1 60 GLY n 1 61 ALA n 1 62 LEU n 1 63 LEU n 1 64 PRO n 1 65 CYS n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 SER n 1 70 ARG n 1 71 PHE n 1 72 GLU n 1 73 ASN n 1 74 LEU n 1 75 GLY n 1 76 VAL n 1 77 SER n 1 78 SER n 1 79 LEU n 1 80 GLY n 1 81 GLU n 1 82 ARG n 1 83 LYS n 1 84 LYS n 1 85 LEU n 1 86 LEU n 1 87 SER n 1 88 TYR n 1 89 ILE n 1 90 GLN n 1 91 ARG n 1 92 LEU n 1 93 VAL n 1 94 GLN n 1 95 ILE n 1 96 HIS n 1 97 VAL n 1 98 ASP n 1 99 THR n 1 100 MET n 1 101 LYS n 1 102 VAL n 1 103 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'SAMHD1, MOP5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060123-30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'CELL-FREE PROTEIN SYNTHESIS' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAMH1_HUMAN _struct_ref.pdbx_db_accession Q9Y3Z3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLS YIQRLVQIHVDTMKVI ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E8O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3Z3 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 118 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E8O GLY A 1 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 1 1 1 2E8O SER A 2 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 2 2 1 2E8O SER A 3 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 3 3 1 2E8O GLY A 4 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 4 4 1 2E8O SER A 5 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 5 5 1 2E8O SER A 6 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 6 6 1 2E8O GLY A 7 ? UNP Q9Y3Z3 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.17mM SAM DOMAIN, 20mM d-TRIS-HCL, 100mM NaCl, 1mM d-DTT, 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E8O _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E8O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E8O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.2.2 'P.GUNTERT ET AL.' 1 'structure solution' CYANA 2.2.2 'P.GUNTERT ET AL.' 2 collection XwinNMR 3.5 BRUKER 3 processing NMRPipe 2003112 'FRANK DELAGLIO' 4 'data analysis' NMRView 5.0.4 'BRUCE A. JOHNSON' 5 'data analysis' KUJIRA 0.899a 'NAOHIRO KOBAYASHI' 6 # _exptl.entry_id 2E8O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E8O _struct.title ;Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E8O _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 26 ? THR A 29 ? ASP A 26 THR A 29 5 ? 4 HELX_P HELX_P2 2 TRP A 30 ? GLY A 43 ? TRP A 30 GLY A 43 1 ? 14 HELX_P HELX_P3 3 GLU A 46 ? ASN A 56 ? GLU A 46 ASN A 56 1 ? 11 HELX_P HELX_P4 4 ASP A 67 ? LEU A 74 ? ASP A 67 LEU A 74 1 ? 8 HELX_P HELX_P5 5 SER A 78 ? GLN A 94 ? SER A 78 GLN A 94 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2E8O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E8O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ILE 103 103 103 ILE ILE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -165.52 114.98 2 1 ASP A 16 ? ? -103.73 52.06 3 1 LEU A 21 ? ? -106.64 -62.23 4 1 GLU A 22 ? ? -171.03 -176.45 5 2 LEU A 92 ? ? -90.72 -66.77 6 3 SER A 2 ? ? -106.73 -71.62 7 3 PRO A 11 ? ? -69.70 79.03 8 3 LEU A 92 ? ? -90.35 -66.75 9 4 PRO A 11 ? ? -69.72 97.53 10 4 LEU A 92 ? ? -90.20 -66.85 11 5 SER A 6 ? ? -160.48 105.28 12 5 THR A 10 ? ? -175.32 140.43 13 5 SER A 12 ? ? -127.82 -69.50 14 5 LEU A 92 ? ? -90.55 -66.70 15 6 PRO A 11 ? ? -69.74 -178.87 16 7 SER A 3 ? ? -170.61 115.36 17 7 SER A 5 ? ? -104.09 -60.42 18 7 SER A 12 ? ? -65.83 -71.88 19 7 ASP A 16 ? ? -160.66 112.28 20 7 LEU A 92 ? ? -90.46 -65.55 21 8 SER A 3 ? ? -104.28 42.90 22 8 ASN A 9 ? ? -133.81 -45.26 23 8 PRO A 11 ? ? -69.77 -172.40 24 8 LEU A 92 ? ? -90.84 -65.89 25 9 LEU A 92 ? ? -90.65 -65.83 26 10 ASN A 9 ? ? -67.31 -71.53 27 10 THR A 10 ? ? 66.04 135.58 28 10 PRO A 11 ? ? -69.80 92.99 29 10 ASP A 16 ? ? -174.52 128.55 30 10 LEU A 92 ? ? -90.54 -66.86 31 11 ALA A 13 ? ? -178.25 126.63 32 11 ALA A 15 ? ? -178.15 -176.80 33 11 ASP A 16 ? ? -59.37 97.79 34 11 TRP A 17 ? ? -171.22 147.21 35 12 LEU A 92 ? ? -90.38 -66.76 36 13 SER A 2 ? ? -57.85 103.93 37 13 THR A 10 ? ? 66.20 135.25 38 13 LEU A 92 ? ? -90.07 -65.94 39 13 VAL A 102 ? ? -174.64 139.12 40 14 PRO A 11 ? ? -69.76 87.21 41 14 ALA A 13 ? ? -105.69 50.34 42 15 SER A 3 ? ? -93.50 -67.14 43 15 PRO A 11 ? ? -69.74 -175.57 44 15 ALA A 13 ? ? -175.70 118.79 45 15 ASP A 16 ? ? -174.65 112.77 46 16 THR A 10 ? ? 66.55 131.86 47 17 SER A 3 ? ? -168.96 114.14 48 17 PRO A 11 ? ? -69.77 -171.14 49 17 ALA A 13 ? ? -142.19 49.72 50 17 ASP A 16 ? ? -60.70 96.56 51 17 TRP A 17 ? ? -170.25 147.53 52 17 LEU A 92 ? ? -90.26 -65.64 53 17 VAL A 102 ? ? -175.02 144.09 54 18 PRO A 11 ? ? -69.74 -178.14 55 18 LEU A 92 ? ? -90.43 -66.09 56 18 VAL A 102 ? ? -141.18 16.55 57 19 GLU A 14 ? ? -143.19 25.89 58 19 ALA A 15 ? ? -174.65 128.60 59 19 LEU A 23 ? ? -66.12 -179.73 60 19 LEU A 92 ? ? -90.06 -66.60 61 19 VAL A 102 ? ? -174.88 139.09 62 20 ASP A 16 ? ? -106.05 47.41 63 20 LEU A 92 ? ? -90.46 -66.49 #