data_2EB2 # _entry.id 2EB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2EB2 RCSB RCSB026450 WWPDB D_1000026450 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2EB3 'MUTATED EGFR KINASE DOMAIN (L858R) IN COMPLEX WITH AMPPNP' unspecified PDB 3VJO 'WILD-TYPE EGFR KINASE DOMAIN IN COMPLEX WITH AMPPNP' unspecified PDB 3VJN 'MUTATED EGFR KINASE DOMAIN (G719S/T790M) IN COMPLEX WITH AMPPNP' unspecified PDB 3UG1 'MUTATED EGFR KINASE DOMAIN (G719S/T790M) IN THE APO FORM' unspecified PDB 3UG2 'MUTATED EGFR KINASE DOMAIN (G719S/T790M) IN COMPLEX WITH GEFITINIB' unspecified TargetDB ar_001000562.1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EB2 _pdbx_database_status.recvd_initial_deposition_date 2007-02-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoshikawa, S.' 1 'Kukimoto-Niino, M.' 2 'Chen, L.' 3 'Liu, Z.J.' 4 'Wang, B.C.' 5 'Shirouzu, M.' 6 'Senba, K.' 7 'Yamamoto, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title ;Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor ; _citation.journal_abbrev Oncogene _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1476-5594 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22349823 _citation.pdbx_database_id_DOI 10.1038/onc.2012.21 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yoshikawa, S.' 1 primary 'Kukimoto-Niino, M.' 2 primary 'Parker, L.' 3 primary 'Handa, N.' 4 primary 'Terada, T.' 5 primary 'Fujimoto, T.' 6 primary 'Terazawa, Y.' 7 primary 'Wakiyama, M.' 8 primary 'Sato, M.' 9 primary 'Sano, S.' 10 primary 'Kobayashi, T.' 11 primary 'Tanaka, T.' 12 primary 'Chen, L.' 13 primary 'Liu, Z.J.' 14 primary 'Wang, B.C.' 15 primary 'Shirouzu, M.' 16 primary 'Kawa, S.' 17 primary 'Semba, K.' 18 primary 'Yamamoto, T.' 19 primary 'Yokoyama, S.' 20 # _cell.entry_id 2EB2 _cell.length_a 145.470 _cell.length_b 145.470 _cell.length_c 145.470 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2EB2 _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 38007.953 1 2.7.10.1 G719S 'kinase domain, UNP residues 695-1022' ? 2 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Receptor tyrosine-protein kinase ErbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGIRSGEAPNQALLRILKETEFKKIKVLSSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMAS VDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTP QHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILE KGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMD DVVDADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGIRSGEAPNQALLRILKETEFKKIKVLSSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMAS VDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTP QHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILE KGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMD DVVDADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000562.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 ILE n 1 6 ARG n 1 7 SER n 1 8 GLY n 1 9 GLU n 1 10 ALA n 1 11 PRO n 1 12 ASN n 1 13 GLN n 1 14 ALA n 1 15 LEU n 1 16 LEU n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 THR n 1 23 GLU n 1 24 PHE n 1 25 LYS n 1 26 LYS n 1 27 ILE n 1 28 LYS n 1 29 VAL n 1 30 LEU n 1 31 SER n 1 32 SER n 1 33 GLY n 1 34 ALA n 1 35 PHE n 1 36 GLY n 1 37 THR n 1 38 VAL n 1 39 TYR n 1 40 LYS n 1 41 GLY n 1 42 LEU n 1 43 TRP n 1 44 ILE n 1 45 PRO n 1 46 GLU n 1 47 GLY n 1 48 GLU n 1 49 LYS n 1 50 VAL n 1 51 LYS n 1 52 ILE n 1 53 PRO n 1 54 VAL n 1 55 ALA n 1 56 ILE n 1 57 LYS n 1 58 GLU n 1 59 LEU n 1 60 ARG n 1 61 GLU n 1 62 ALA n 1 63 THR n 1 64 SER n 1 65 PRO n 1 66 LYS n 1 67 ALA n 1 68 ASN n 1 69 LYS n 1 70 GLU n 1 71 ILE n 1 72 LEU n 1 73 ASP n 1 74 GLU n 1 75 ALA n 1 76 TYR n 1 77 VAL n 1 78 MET n 1 79 ALA n 1 80 SER n 1 81 VAL n 1 82 ASP n 1 83 ASN n 1 84 PRO n 1 85 HIS n 1 86 VAL n 1 87 CYS n 1 88 ARG n 1 89 LEU n 1 90 LEU n 1 91 GLY n 1 92 ILE n 1 93 CYS n 1 94 LEU n 1 95 THR n 1 96 SER n 1 97 THR n 1 98 VAL n 1 99 GLN n 1 100 LEU n 1 101 ILE n 1 102 THR n 1 103 GLN n 1 104 LEU n 1 105 MET n 1 106 PRO n 1 107 PHE n 1 108 GLY n 1 109 CYS n 1 110 LEU n 1 111 LEU n 1 112 ASP n 1 113 TYR n 1 114 VAL n 1 115 ARG n 1 116 GLU n 1 117 HIS n 1 118 LYS n 1 119 ASP n 1 120 ASN n 1 121 ILE n 1 122 GLY n 1 123 SER n 1 124 GLN n 1 125 TYR n 1 126 LEU n 1 127 LEU n 1 128 ASN n 1 129 TRP n 1 130 CYS n 1 131 VAL n 1 132 GLN n 1 133 ILE n 1 134 ALA n 1 135 LYS n 1 136 GLY n 1 137 MET n 1 138 ASN n 1 139 TYR n 1 140 LEU n 1 141 GLU n 1 142 ASP n 1 143 ARG n 1 144 ARG n 1 145 LEU n 1 146 VAL n 1 147 HIS n 1 148 ARG n 1 149 ASP n 1 150 LEU n 1 151 ALA n 1 152 ALA n 1 153 ARG n 1 154 ASN n 1 155 VAL n 1 156 LEU n 1 157 VAL n 1 158 LYS n 1 159 THR n 1 160 PRO n 1 161 GLN n 1 162 HIS n 1 163 VAL n 1 164 LYS n 1 165 ILE n 1 166 THR n 1 167 ASP n 1 168 PHE n 1 169 GLY n 1 170 LEU n 1 171 ALA n 1 172 LYS n 1 173 LEU n 1 174 LEU n 1 175 GLY n 1 176 ALA n 1 177 GLU n 1 178 GLU n 1 179 LYS n 1 180 GLU n 1 181 TYR n 1 182 HIS n 1 183 ALA n 1 184 GLU n 1 185 GLY n 1 186 GLY n 1 187 LYS n 1 188 VAL n 1 189 PRO n 1 190 ILE n 1 191 LYS n 1 192 TRP n 1 193 MET n 1 194 ALA n 1 195 LEU n 1 196 GLU n 1 197 SER n 1 198 ILE n 1 199 LEU n 1 200 HIS n 1 201 ARG n 1 202 ILE n 1 203 TYR n 1 204 THR n 1 205 HIS n 1 206 GLN n 1 207 SER n 1 208 ASP n 1 209 VAL n 1 210 TRP n 1 211 SER n 1 212 TYR n 1 213 GLY n 1 214 VAL n 1 215 THR n 1 216 VAL n 1 217 TRP n 1 218 GLU n 1 219 LEU n 1 220 MET n 1 221 THR n 1 222 PHE n 1 223 GLY n 1 224 SER n 1 225 LYS n 1 226 PRO n 1 227 TYR n 1 228 ASP n 1 229 GLY n 1 230 ILE n 1 231 PRO n 1 232 ALA n 1 233 SER n 1 234 GLU n 1 235 ILE n 1 236 SER n 1 237 SER n 1 238 ILE n 1 239 LEU n 1 240 GLU n 1 241 LYS n 1 242 GLY n 1 243 GLU n 1 244 ARG n 1 245 LEU n 1 246 PRO n 1 247 GLN n 1 248 PRO n 1 249 PRO n 1 250 ILE n 1 251 CYS n 1 252 THR n 1 253 ILE n 1 254 ASP n 1 255 VAL n 1 256 TYR n 1 257 MET n 1 258 ILE n 1 259 MET n 1 260 VAL n 1 261 LYS n 1 262 CYS n 1 263 TRP n 1 264 MET n 1 265 ILE n 1 266 ASP n 1 267 ALA n 1 268 ASP n 1 269 SER n 1 270 ARG n 1 271 PRO n 1 272 LYS n 1 273 PHE n 1 274 ARG n 1 275 GLU n 1 276 LEU n 1 277 ILE n 1 278 ILE n 1 279 GLU n 1 280 PHE n 1 281 SER n 1 282 LYS n 1 283 MET n 1 284 ALA n 1 285 ARG n 1 286 ASP n 1 287 PRO n 1 288 GLN n 1 289 ARG n 1 290 TYR n 1 291 LEU n 1 292 VAL n 1 293 ILE n 1 294 GLN n 1 295 GLY n 1 296 ASP n 1 297 GLU n 1 298 ARG n 1 299 MET n 1 300 HIS n 1 301 LEU n 1 302 PRO n 1 303 SER n 1 304 PRO n 1 305 THR n 1 306 ASP n 1 307 SER n 1 308 ASN n 1 309 PHE n 1 310 TYR n 1 311 ARG n 1 312 ALA n 1 313 LEU n 1 314 MET n 1 315 ASP n 1 316 GLU n 1 317 GLU n 1 318 ASP n 1 319 MET n 1 320 ASP n 1 321 ASP n 1 322 VAL n 1 323 VAL n 1 324 ASP n 1 325 ALA n 1 326 ASP n 1 327 GLU n 1 328 TYR n 1 329 LEU n 1 330 ILE n 1 331 PRO n 1 332 GLN n 1 333 GLN n 1 334 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene EGFR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus Spodoptera _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Sf9 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector pFastBac_HT_C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EB2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 334 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EB2 GLY A 1 ? UNP P00533 ? ? 'EXPRESSION TAG' 689 1 1 2EB2 ALA A 2 ? UNP P00533 ? ? 'EXPRESSION TAG' 690 2 1 2EB2 MET A 3 ? UNP P00533 ? ? 'EXPRESSION TAG' 691 3 1 2EB2 GLY A 4 ? UNP P00533 ? ? 'EXPRESSION TAG' 692 4 1 2EB2 ILE A 5 ? UNP P00533 ? ? 'EXPRESSION TAG' 693 5 1 2EB2 ARG A 6 ? UNP P00533 ? ? 'EXPRESSION TAG' 694 6 1 2EB2 SER A 31 ? UNP P00533 GLY 719 'SEE REMARK 999' 719 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2EB2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.37 _exptl_crystal.density_percent_sol 63.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '0.1M MES, 1.1M Na/K tartrate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2006-08-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97243 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97243 # _reflns.entry_id 2EB2 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.5 _reflns.number_obs 17866 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.137 _reflns.pdbx_netI_over_sigmaI 35.357 _reflns.B_iso_Wilson_estimate 46.0 _reflns.pdbx_redundancy 43.094 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.484 _reflns_shell.meanI_over_sigI_obs 9.75 _reflns_shell.pdbx_redundancy 33.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2EB2 _refine.ls_number_reflns_obs 17863 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 2990657.37 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 46.00 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.198 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.198 _refine.ls_R_factor_R_free 0.253 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 1755 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 58.2 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.367323 _refine.solvent_model_param_bsol 48.7334 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1M14' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2EB2 _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs 0.22 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.38 _refine_analyze.Luzzati_sigma_a_free 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2443 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 2459 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 46.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.07 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 6.74 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 8.83 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 10.49 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 12.33 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_R_work 2613 _refine_ls_shell.R_factor_R_work 0.254 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.330 _refine_ls_shell.R_factor_R_free_error 0.019 _refine_ls_shell.percent_reflns_R_free 10.8 _refine_ls_shell.number_reflns_R_free 315 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' # _struct.entry_id 2EB2 _struct.title 'Crystal structure of mutated EGFR kinase domain (G719S)' _struct.pdbx_descriptor 'Epidermal growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EB2 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Kinase, Tyrosine-protein kinase, Receptor, Transferase, Phosphorylation, ATP-binding, Disease mutation, Transmembrane, Cell cycle, EC 2.7.10.1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 20 ? THR A 22 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 2 SER A 64 ? SER A 80 ? SER A 752 SER A 768 1 ? 17 HELX_P HELX_P3 3 CYS A 109 ? LYS A 118 ? CYS A 797 LYS A 806 1 ? 10 HELX_P HELX_P4 4 ASP A 119 ? ILE A 121 ? ASP A 807 ILE A 809 5 ? 3 HELX_P HELX_P5 5 GLY A 122 ? ARG A 143 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 6 ALA A 151 ? ARG A 153 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 7 PRO A 189 ? MET A 193 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 8 ALA A 194 ? ARG A 201 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 9 THR A 204 ? THR A 221 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 10 PRO A 231 ? LYS A 241 ? PRO A 919 LYS A 929 1 ? 11 HELX_P HELX_P11 11 THR A 252 ? TRP A 263 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P12 12 ASP A 266 ? ARG A 270 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P13 13 LYS A 272 ? ARG A 285 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P14 14 ASP A 286 ? TYR A 290 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P15 15 ASP A 324 ? TYR A 328 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 24 ? VAL A 29 ? PHE A 712 VAL A 717 A 2 VAL A 38 ? TRP A 43 ? VAL A 726 TRP A 731 A 3 ILE A 52 ? GLU A 58 ? ILE A 740 GLU A 746 A 4 VAL A 98 ? GLN A 103 ? VAL A 786 GLN A 791 A 5 LEU A 89 ? LEU A 94 ? LEU A 777 LEU A 782 B 1 LEU A 145 ? VAL A 146 ? LEU A 833 VAL A 834 B 2 LYS A 172 ? LEU A 173 ? LYS A 860 LEU A 861 C 1 VAL A 155 ? THR A 159 ? VAL A 843 THR A 847 C 2 HIS A 162 ? ILE A 165 ? HIS A 850 ILE A 853 D 1 TYR A 181 ? HIS A 182 ? TYR A 869 HIS A 870 D 2 ILE A 202 ? TYR A 203 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 28 ? N LYS A 716 O LYS A 40 ? O LYS A 728 A 2 3 N TYR A 39 ? N TYR A 727 O ILE A 56 ? O ILE A 744 A 3 4 N ALA A 55 ? N ALA A 743 O THR A 102 ? O THR A 790 A 4 5 O ILE A 101 ? O ILE A 789 N GLY A 91 ? N GLY A 779 B 1 2 N VAL A 146 ? N VAL A 834 O LYS A 172 ? O LYS A 860 C 1 2 N LEU A 156 ? N LEU A 844 O LYS A 164 ? O LYS A 852 D 1 2 N TYR A 181 ? N TYR A 869 O TYR A 203 ? O TYR A 891 # _database_PDB_matrix.entry_id 2EB2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EB2 _atom_sites.fract_transf_matrix[1][1] 0.006874 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006874 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006874 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 689 ? ? ? A . n A 1 2 ALA 2 690 ? ? ? A . n A 1 3 MET 3 691 ? ? ? A . n A 1 4 GLY 4 692 ? ? ? A . n A 1 5 ILE 5 693 ? ? ? A . n A 1 6 ARG 6 694 ? ? ? A . n A 1 7 SER 7 695 ? ? ? A . n A 1 8 GLY 8 696 696 GLY GLY A . n A 1 9 GLU 9 697 697 GLU GLU A . n A 1 10 ALA 10 698 698 ALA ALA A . n A 1 11 PRO 11 699 699 PRO PRO A . n A 1 12 ASN 12 700 700 ASN ASN A . n A 1 13 GLN 13 701 701 GLN GLN A . n A 1 14 ALA 14 702 702 ALA ALA A . n A 1 15 LEU 15 703 703 LEU LEU A . n A 1 16 LEU 16 704 704 LEU LEU A . n A 1 17 ARG 17 705 705 ARG ARG A . n A 1 18 ILE 18 706 706 ILE ILE A . n A 1 19 LEU 19 707 707 LEU LEU A . n A 1 20 LYS 20 708 708 LYS LYS A . n A 1 21 GLU 21 709 709 GLU GLU A . n A 1 22 THR 22 710 710 THR THR A . n A 1 23 GLU 23 711 711 GLU GLU A . n A 1 24 PHE 24 712 712 PHE PHE A . n A 1 25 LYS 25 713 713 LYS LYS A . n A 1 26 LYS 26 714 714 LYS LYS A . n A 1 27 ILE 27 715 715 ILE ILE A . n A 1 28 LYS 28 716 716 LYS LYS A . n A 1 29 VAL 29 717 717 VAL VAL A . n A 1 30 LEU 30 718 718 LEU LEU A . n A 1 31 SER 31 719 719 SER SER A . n A 1 32 SER 32 720 720 SER SER A . n A 1 33 GLY 33 721 ? ? ? A . n A 1 34 ALA 34 722 ? ? ? A . n A 1 35 PHE 35 723 ? ? ? A . n A 1 36 GLY 36 724 724 GLY GLY A . n A 1 37 THR 37 725 725 THR THR A . n A 1 38 VAL 38 726 726 VAL VAL A . n A 1 39 TYR 39 727 727 TYR TYR A . n A 1 40 LYS 40 728 728 LYS LYS A . n A 1 41 GLY 41 729 729 GLY GLY A . n A 1 42 LEU 42 730 730 LEU LEU A . n A 1 43 TRP 43 731 731 TRP TRP A . n A 1 44 ILE 44 732 732 ILE ILE A . n A 1 45 PRO 45 733 733 PRO PRO A . n A 1 46 GLU 46 734 734 GLU GLU A . n A 1 47 GLY 47 735 735 GLY GLY A . n A 1 48 GLU 48 736 736 GLU GLU A . n A 1 49 LYS 49 737 737 LYS LYS A . n A 1 50 VAL 50 738 738 VAL VAL A . n A 1 51 LYS 51 739 739 LYS LYS A . n A 1 52 ILE 52 740 740 ILE ILE A . n A 1 53 PRO 53 741 741 PRO PRO A . n A 1 54 VAL 54 742 742 VAL VAL A . n A 1 55 ALA 55 743 743 ALA ALA A . n A 1 56 ILE 56 744 744 ILE ILE A . n A 1 57 LYS 57 745 745 LYS LYS A . n A 1 58 GLU 58 746 746 GLU GLU A . n A 1 59 LEU 59 747 747 LEU LEU A . n A 1 60 ARG 60 748 748 ARG ARG A . n A 1 61 GLU 61 749 ? ? ? A . n A 1 62 ALA 62 750 750 ALA ALA A . n A 1 63 THR 63 751 751 THR THR A . n A 1 64 SER 64 752 752 SER SER A . n A 1 65 PRO 65 753 753 PRO PRO A . n A 1 66 LYS 66 754 754 LYS LYS A . n A 1 67 ALA 67 755 755 ALA ALA A . n A 1 68 ASN 68 756 756 ASN ASN A . n A 1 69 LYS 69 757 757 LYS LYS A . n A 1 70 GLU 70 758 758 GLU GLU A . n A 1 71 ILE 71 759 759 ILE ILE A . n A 1 72 LEU 72 760 760 LEU LEU A . n A 1 73 ASP 73 761 761 ASP ASP A . n A 1 74 GLU 74 762 762 GLU GLU A . n A 1 75 ALA 75 763 763 ALA ALA A . n A 1 76 TYR 76 764 764 TYR TYR A . n A 1 77 VAL 77 765 765 VAL VAL A . n A 1 78 MET 78 766 766 MET MET A . n A 1 79 ALA 79 767 767 ALA ALA A . n A 1 80 SER 80 768 768 SER SER A . n A 1 81 VAL 81 769 769 VAL VAL A . n A 1 82 ASP 82 770 770 ASP ASP A . n A 1 83 ASN 83 771 771 ASN ASN A . n A 1 84 PRO 84 772 772 PRO PRO A . n A 1 85 HIS 85 773 773 HIS HIS A . n A 1 86 VAL 86 774 774 VAL VAL A . n A 1 87 CYS 87 775 775 CYS CYS A . n A 1 88 ARG 88 776 776 ARG ARG A . n A 1 89 LEU 89 777 777 LEU LEU A . n A 1 90 LEU 90 778 778 LEU LEU A . n A 1 91 GLY 91 779 779 GLY GLY A . n A 1 92 ILE 92 780 780 ILE ILE A . n A 1 93 CYS 93 781 781 CYS CYS A . n A 1 94 LEU 94 782 782 LEU LEU A . n A 1 95 THR 95 783 783 THR THR A . n A 1 96 SER 96 784 784 SER SER A . n A 1 97 THR 97 785 785 THR THR A . n A 1 98 VAL 98 786 786 VAL VAL A . n A 1 99 GLN 99 787 787 GLN GLN A . n A 1 100 LEU 100 788 788 LEU LEU A . n A 1 101 ILE 101 789 789 ILE ILE A . n A 1 102 THR 102 790 790 THR THR A . n A 1 103 GLN 103 791 791 GLN GLN A . n A 1 104 LEU 104 792 792 LEU LEU A . n A 1 105 MET 105 793 793 MET MET A . n A 1 106 PRO 106 794 794 PRO PRO A . n A 1 107 PHE 107 795 795 PHE PHE A . n A 1 108 GLY 108 796 796 GLY GLY A . n A 1 109 CYS 109 797 797 CYS CYS A . n A 1 110 LEU 110 798 798 LEU LEU A . n A 1 111 LEU 111 799 799 LEU LEU A . n A 1 112 ASP 112 800 800 ASP ASP A . n A 1 113 TYR 113 801 801 TYR TYR A . n A 1 114 VAL 114 802 802 VAL VAL A . n A 1 115 ARG 115 803 803 ARG ARG A . n A 1 116 GLU 116 804 804 GLU GLU A . n A 1 117 HIS 117 805 805 HIS HIS A . n A 1 118 LYS 118 806 806 LYS LYS A . n A 1 119 ASP 119 807 807 ASP ASP A . n A 1 120 ASN 120 808 808 ASN ASN A . n A 1 121 ILE 121 809 809 ILE ILE A . n A 1 122 GLY 122 810 810 GLY GLY A . n A 1 123 SER 123 811 811 SER SER A . n A 1 124 GLN 124 812 812 GLN GLN A . n A 1 125 TYR 125 813 813 TYR TYR A . n A 1 126 LEU 126 814 814 LEU LEU A . n A 1 127 LEU 127 815 815 LEU LEU A . n A 1 128 ASN 128 816 816 ASN ASN A . n A 1 129 TRP 129 817 817 TRP TRP A . n A 1 130 CYS 130 818 818 CYS CYS A . n A 1 131 VAL 131 819 819 VAL VAL A . n A 1 132 GLN 132 820 820 GLN GLN A . n A 1 133 ILE 133 821 821 ILE ILE A . n A 1 134 ALA 134 822 822 ALA ALA A . n A 1 135 LYS 135 823 823 LYS LYS A . n A 1 136 GLY 136 824 824 GLY GLY A . n A 1 137 MET 137 825 825 MET MET A . n A 1 138 ASN 138 826 826 ASN ASN A . n A 1 139 TYR 139 827 827 TYR TYR A . n A 1 140 LEU 140 828 828 LEU LEU A . n A 1 141 GLU 141 829 829 GLU GLU A . n A 1 142 ASP 142 830 830 ASP ASP A . n A 1 143 ARG 143 831 831 ARG ARG A . n A 1 144 ARG 144 832 832 ARG ARG A . n A 1 145 LEU 145 833 833 LEU LEU A . n A 1 146 VAL 146 834 834 VAL VAL A . n A 1 147 HIS 147 835 835 HIS HIS A . n A 1 148 ARG 148 836 836 ARG ARG A . n A 1 149 ASP 149 837 837 ASP ASP A . n A 1 150 LEU 150 838 838 LEU LEU A . n A 1 151 ALA 151 839 839 ALA ALA A . n A 1 152 ALA 152 840 840 ALA ALA A . n A 1 153 ARG 153 841 841 ARG ARG A . n A 1 154 ASN 154 842 842 ASN ASN A . n A 1 155 VAL 155 843 843 VAL VAL A . n A 1 156 LEU 156 844 844 LEU LEU A . n A 1 157 VAL 157 845 845 VAL VAL A . n A 1 158 LYS 158 846 846 LYS LYS A . n A 1 159 THR 159 847 847 THR THR A . n A 1 160 PRO 160 848 848 PRO PRO A . n A 1 161 GLN 161 849 849 GLN GLN A . n A 1 162 HIS 162 850 850 HIS HIS A . n A 1 163 VAL 163 851 851 VAL VAL A . n A 1 164 LYS 164 852 852 LYS LYS A . n A 1 165 ILE 165 853 853 ILE ILE A . n A 1 166 THR 166 854 854 THR THR A . n A 1 167 ASP 167 855 855 ASP ASP A . n A 1 168 PHE 168 856 856 PHE PHE A . n A 1 169 GLY 169 857 857 GLY GLY A . n A 1 170 LEU 170 858 858 LEU LEU A . n A 1 171 ALA 171 859 859 ALA ALA A . n A 1 172 LYS 172 860 860 LYS LYS A . n A 1 173 LEU 173 861 861 LEU LEU A . n A 1 174 LEU 174 862 862 LEU LEU A . n A 1 175 GLY 175 863 863 GLY GLY A . n A 1 176 ALA 176 864 864 ALA ALA A . n A 1 177 GLU 177 865 ? ? ? A . n A 1 178 GLU 178 866 866 GLU GLU A . n A 1 179 LYS 179 867 867 LYS LYS A . n A 1 180 GLU 180 868 868 GLU GLU A . n A 1 181 TYR 181 869 869 TYR TYR A . n A 1 182 HIS 182 870 870 HIS HIS A . n A 1 183 ALA 183 871 871 ALA ALA A . n A 1 184 GLU 184 872 872 GLU GLU A . n A 1 185 GLY 185 873 873 GLY GLY A . n A 1 186 GLY 186 874 874 GLY GLY A . n A 1 187 LYS 187 875 875 LYS LYS A . n A 1 188 VAL 188 876 876 VAL VAL A . n A 1 189 PRO 189 877 877 PRO PRO A . n A 1 190 ILE 190 878 878 ILE ILE A . n A 1 191 LYS 191 879 879 LYS LYS A . n A 1 192 TRP 192 880 880 TRP TRP A . n A 1 193 MET 193 881 881 MET MET A . n A 1 194 ALA 194 882 882 ALA ALA A . n A 1 195 LEU 195 883 883 LEU LEU A . n A 1 196 GLU 196 884 884 GLU GLU A . n A 1 197 SER 197 885 885 SER SER A . n A 1 198 ILE 198 886 886 ILE ILE A . n A 1 199 LEU 199 887 887 LEU LEU A . n A 1 200 HIS 200 888 888 HIS HIS A . n A 1 201 ARG 201 889 889 ARG ARG A . n A 1 202 ILE 202 890 890 ILE ILE A . n A 1 203 TYR 203 891 891 TYR TYR A . n A 1 204 THR 204 892 892 THR THR A . n A 1 205 HIS 205 893 893 HIS HIS A . n A 1 206 GLN 206 894 894 GLN GLN A . n A 1 207 SER 207 895 895 SER SER A . n A 1 208 ASP 208 896 896 ASP ASP A . n A 1 209 VAL 209 897 897 VAL VAL A . n A 1 210 TRP 210 898 898 TRP TRP A . n A 1 211 SER 211 899 899 SER SER A . n A 1 212 TYR 212 900 900 TYR TYR A . n A 1 213 GLY 213 901 901 GLY GLY A . n A 1 214 VAL 214 902 902 VAL VAL A . n A 1 215 THR 215 903 903 THR THR A . n A 1 216 VAL 216 904 904 VAL VAL A . n A 1 217 TRP 217 905 905 TRP TRP A . n A 1 218 GLU 218 906 906 GLU GLU A . n A 1 219 LEU 219 907 907 LEU LEU A . n A 1 220 MET 220 908 908 MET MET A . n A 1 221 THR 221 909 909 THR THR A . n A 1 222 PHE 222 910 910 PHE PHE A . n A 1 223 GLY 223 911 911 GLY GLY A . n A 1 224 SER 224 912 912 SER SER A . n A 1 225 LYS 225 913 913 LYS LYS A . n A 1 226 PRO 226 914 914 PRO PRO A . n A 1 227 TYR 227 915 915 TYR TYR A . n A 1 228 ASP 228 916 916 ASP ASP A . n A 1 229 GLY 229 917 917 GLY GLY A . n A 1 230 ILE 230 918 918 ILE ILE A . n A 1 231 PRO 231 919 919 PRO PRO A . n A 1 232 ALA 232 920 920 ALA ALA A . n A 1 233 SER 233 921 921 SER SER A . n A 1 234 GLU 234 922 922 GLU GLU A . n A 1 235 ILE 235 923 923 ILE ILE A . n A 1 236 SER 236 924 924 SER SER A . n A 1 237 SER 237 925 925 SER SER A . n A 1 238 ILE 238 926 926 ILE ILE A . n A 1 239 LEU 239 927 927 LEU LEU A . n A 1 240 GLU 240 928 928 GLU GLU A . n A 1 241 LYS 241 929 929 LYS LYS A . n A 1 242 GLY 242 930 930 GLY GLY A . n A 1 243 GLU 243 931 931 GLU GLU A . n A 1 244 ARG 244 932 932 ARG ARG A . n A 1 245 LEU 245 933 933 LEU LEU A . n A 1 246 PRO 246 934 934 PRO PRO A . n A 1 247 GLN 247 935 935 GLN GLN A . n A 1 248 PRO 248 936 936 PRO PRO A . n A 1 249 PRO 249 937 937 PRO PRO A . n A 1 250 ILE 250 938 938 ILE ILE A . n A 1 251 CYS 251 939 939 CYS CYS A . n A 1 252 THR 252 940 940 THR THR A . n A 1 253 ILE 253 941 941 ILE ILE A . n A 1 254 ASP 254 942 942 ASP ASP A . n A 1 255 VAL 255 943 943 VAL VAL A . n A 1 256 TYR 256 944 944 TYR TYR A . n A 1 257 MET 257 945 945 MET MET A . n A 1 258 ILE 258 946 946 ILE ILE A . n A 1 259 MET 259 947 947 MET MET A . n A 1 260 VAL 260 948 948 VAL VAL A . n A 1 261 LYS 261 949 949 LYS LYS A . n A 1 262 CYS 262 950 950 CYS CYS A . n A 1 263 TRP 263 951 951 TRP TRP A . n A 1 264 MET 264 952 952 MET MET A . n A 1 265 ILE 265 953 953 ILE ILE A . n A 1 266 ASP 266 954 954 ASP ASP A . n A 1 267 ALA 267 955 955 ALA ALA A . n A 1 268 ASP 268 956 956 ASP ASP A . n A 1 269 SER 269 957 957 SER SER A . n A 1 270 ARG 270 958 958 ARG ARG A . n A 1 271 PRO 271 959 959 PRO PRO A . n A 1 272 LYS 272 960 960 LYS LYS A . n A 1 273 PHE 273 961 961 PHE PHE A . n A 1 274 ARG 274 962 962 ARG ARG A . n A 1 275 GLU 275 963 963 GLU GLU A . n A 1 276 LEU 276 964 964 LEU LEU A . n A 1 277 ILE 277 965 965 ILE ILE A . n A 1 278 ILE 278 966 966 ILE ILE A . n A 1 279 GLU 279 967 967 GLU GLU A . n A 1 280 PHE 280 968 968 PHE PHE A . n A 1 281 SER 281 969 969 SER SER A . n A 1 282 LYS 282 970 970 LYS LYS A . n A 1 283 MET 283 971 971 MET MET A . n A 1 284 ALA 284 972 972 ALA ALA A . n A 1 285 ARG 285 973 973 ARG ARG A . n A 1 286 ASP 286 974 974 ASP ASP A . n A 1 287 PRO 287 975 975 PRO PRO A . n A 1 288 GLN 288 976 976 GLN GLN A . n A 1 289 ARG 289 977 977 ARG ARG A . n A 1 290 TYR 290 978 978 TYR TYR A . n A 1 291 LEU 291 979 979 LEU LEU A . n A 1 292 VAL 292 980 980 VAL VAL A . n A 1 293 ILE 293 981 981 ILE ILE A . n A 1 294 GLN 294 982 982 GLN GLN A . n A 1 295 GLY 295 983 983 GLY GLY A . n A 1 296 ASP 296 984 984 ASP ASP A . n A 1 297 GLU 297 985 985 GLU GLU A . n A 1 298 ARG 298 986 986 ARG ARG A . n A 1 299 MET 299 987 987 MET MET A . n A 1 300 HIS 300 988 988 HIS HIS A . n A 1 301 LEU 301 989 989 LEU LEU A . n A 1 302 PRO 302 990 990 PRO PRO A . n A 1 303 SER 303 991 ? ? ? A . n A 1 304 PRO 304 992 ? ? ? A . n A 1 305 THR 305 993 ? ? ? A . n A 1 306 ASP 306 994 ? ? ? A . n A 1 307 SER 307 995 ? ? ? A . n A 1 308 ASN 308 996 ? ? ? A . n A 1 309 PHE 309 997 ? ? ? A . n A 1 310 TYR 310 998 ? ? ? A . n A 1 311 ARG 311 999 ? ? ? A . n A 1 312 ALA 312 1000 ? ? ? A . n A 1 313 LEU 313 1001 ? ? ? A . n A 1 314 MET 314 1002 ? ? ? A . n A 1 315 ASP 315 1003 ? ? ? A . n A 1 316 GLU 316 1004 ? ? ? A . n A 1 317 GLU 317 1005 1005 GLU GLU A . n A 1 318 ASP 318 1006 1006 ASP ASP A . n A 1 319 MET 319 1007 1007 MET MET A . n A 1 320 ASP 320 1008 1008 ASP ASP A . n A 1 321 ASP 321 1009 1009 ASP ASP A . n A 1 322 VAL 322 1010 1010 VAL VAL A . n A 1 323 VAL 323 1011 1011 VAL VAL A . n A 1 324 ASP 324 1012 1012 ASP ASP A . n A 1 325 ALA 325 1013 1013 ALA ALA A . n A 1 326 ASP 326 1014 1014 ASP ASP A . n A 1 327 GLU 327 1015 1015 GLU GLU A . n A 1 328 TYR 328 1016 1016 TYR TYR A . n A 1 329 LEU 329 1017 1017 LEU LEU A . n A 1 330 ILE 330 1018 1018 ILE ILE A . n A 1 331 PRO 331 1019 1019 PRO PRO A . n A 1 332 GLN 332 1020 ? ? ? A . n A 1 333 GLN 333 1021 ? ? ? A . n A 1 334 GLY 334 1022 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1 1 HOH HOH A . B 2 HOH 2 2 2 HOH HOH A . B 2 HOH 3 3 3 HOH HOH A . B 2 HOH 4 4 4 HOH HOH A . B 2 HOH 5 5 5 HOH HOH A . B 2 HOH 6 6 6 HOH HOH A . B 2 HOH 7 7 7 HOH HOH A . B 2 HOH 8 8 8 HOH HOH A . B 2 HOH 9 9 9 HOH HOH A . B 2 HOH 10 10 10 HOH HOH A . B 2 HOH 11 11 11 HOH HOH A . B 2 HOH 12 12 12 HOH HOH A . B 2 HOH 13 13 13 HOH HOH A . B 2 HOH 14 14 14 HOH HOH A . B 2 HOH 15 15 15 HOH HOH A . B 2 HOH 16 16 16 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 20_555 -z+1/2,x+1/2,-y+1/2 0.0000000000 0.0000000000 -1.0000000000 72.7350000000 1.0000000000 0.0000000000 0.0000000000 72.7350000000 0.0000000000 -1.0000000000 0.0000000000 72.7350000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-03-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data collection' . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 MOLREP phasing . ? 5 # _pdbx_entry_details.entry_id 2EB2 _pdbx_entry_details.sequence_details 'THE RESIDUE IS SOMATIC MUTATION IN LUNG CANCER.' _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 806 ? ? -26.48 -64.93 2 1 ASP A 807 ? ? -54.04 -8.16 3 1 ARG A 836 ? ? 69.57 -2.64 4 1 ASP A 837 ? ? -149.14 43.77 5 1 ASP A 855 ? ? 55.66 80.97 6 1 GLU A 872 ? ? -97.17 -93.96 7 1 LYS A 875 ? ? -37.18 126.05 8 1 ASP A 916 ? ? -43.30 -14.91 9 1 ILE A 918 ? ? -28.37 137.60 10 1 ARG A 986 ? ? -76.52 46.13 11 1 ILE A 1018 ? ? 40.24 -168.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 689 ? A GLY 1 2 1 Y 1 A ALA 690 ? A ALA 2 3 1 Y 1 A MET 691 ? A MET 3 4 1 Y 1 A GLY 692 ? A GLY 4 5 1 Y 1 A ILE 693 ? A ILE 5 6 1 Y 1 A ARG 694 ? A ARG 6 7 1 Y 1 A SER 695 ? A SER 7 8 1 Y 1 A GLY 721 ? A GLY 33 9 1 Y 1 A ALA 722 ? A ALA 34 10 1 Y 1 A PHE 723 ? A PHE 35 11 1 Y 1 A GLU 749 ? A GLU 61 12 1 Y 1 A GLU 865 ? A GLU 177 13 1 Y 1 A SER 991 ? A SER 303 14 1 Y 1 A PRO 992 ? A PRO 304 15 1 Y 1 A THR 993 ? A THR 305 16 1 Y 1 A ASP 994 ? A ASP 306 17 1 Y 1 A SER 995 ? A SER 307 18 1 Y 1 A ASN 996 ? A ASN 308 19 1 Y 1 A PHE 997 ? A PHE 309 20 1 Y 1 A TYR 998 ? A TYR 310 21 1 Y 1 A ARG 999 ? A ARG 311 22 1 Y 1 A ALA 1000 ? A ALA 312 23 1 Y 1 A LEU 1001 ? A LEU 313 24 1 Y 1 A MET 1002 ? A MET 314 25 1 Y 1 A ASP 1003 ? A ASP 315 26 1 Y 1 A GLU 1004 ? A GLU 316 27 1 Y 1 A GLN 1020 ? A GLN 332 28 1 Y 1 A GLN 1021 ? A GLN 333 29 1 Y 1 A GLY 1022 ? A GLY 334 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #