data_2EBR # _entry.id 2EBR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EBR pdb_00002ebr 10.2210/pdb2ebr/pdb RCSB RCSB026473 ? ? WWPDB D_1000026473 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 3 'Structure model' '_struct_ref_seq_dif.details' 17 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EBR _pdbx_database_status.recvd_initial_deposition_date 2007-02-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2EBQ 'the second zf-RanBP domain of the same protein' unspecified TargetDB hso002001298.3 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the fourth zf-RanBP domain from human Nuclear pore complex protein Nup153' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear pore complex protein Nup153' 4777.242 1 ? ? 'zf-RanBP domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nucleoporin Nup153, 153 kDa nucleoporin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDT _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002001298.3 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 GLU n 1 10 GLY n 1 11 SER n 1 12 TRP n 1 13 ASP n 1 14 CYS n 1 15 GLU n 1 16 LEU n 1 17 CYS n 1 18 LEU n 1 19 VAL n 1 20 GLN n 1 21 ASN n 1 22 LYS n 1 23 ALA n 1 24 ASP n 1 25 SER n 1 26 THR n 1 27 LYS n 1 28 CYS n 1 29 LEU n 1 30 ALA n 1 31 CYS n 1 32 GLU n 1 33 SER n 1 34 ALA n 1 35 LYS n 1 36 PRO n 1 37 GLY n 1 38 THR n 1 39 LYS n 1 40 SER n 1 41 GLY n 1 42 PHE n 1 43 LYS n 1 44 GLY n 1 45 PHE n 1 46 ASP n 1 47 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NUP153 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060123-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 THR 47 47 47 THR THR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2EBR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EBR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EBR _struct.title 'Solution structure of the fourth zf-RanBP domain from human Nuclear pore complex protein Nup153' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EBR _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text ;zf-RanBP domain, Nuclear pore complex protein, Nucleoporin Nup153, 153 kDa nucleoporin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NU153_HUMAN _struct_ref.pdbx_db_accession P49790 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDT _struct_ref.pdbx_align_begin 851 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EBR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49790 _struct_ref_seq.db_align_beg 851 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 890 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 47 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EBR GLY A 1 ? UNP P49790 ? ? 'cloning artifact' 1 1 1 2EBR SER A 2 ? UNP P49790 ? ? 'cloning artifact' 2 2 1 2EBR SER A 3 ? UNP P49790 ? ? 'cloning artifact' 3 3 1 2EBR GLY A 4 ? UNP P49790 ? ? 'cloning artifact' 4 4 1 2EBR SER A 5 ? UNP P49790 ? ? 'cloning artifact' 5 5 1 2EBR SER A 6 ? UNP P49790 ? ? 'cloning artifact' 6 6 1 2EBR GLY A 7 ? UNP P49790 ? ? 'cloning artifact' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.250 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 110.2 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 108.2 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 105.1 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 114.0 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 113.6 ? 6 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 105.1 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 3 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 4 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 PRO A 8 ? ? -69.78 2.85 2 3 PRO A 8 ? ? -69.78 3.18 3 3 SER A 25 ? ? -59.32 103.34 4 4 PRO A 8 ? ? -69.71 3.79 5 5 PRO A 8 ? ? -69.72 87.37 6 6 PRO A 8 ? ? -69.75 1.65 7 6 PRO A 36 ? ? -69.79 91.71 8 9 SER A 5 ? ? -95.90 -62.04 9 10 PRO A 8 ? ? -69.79 82.81 10 10 PRO A 36 ? ? -69.76 86.17 11 11 PRO A 8 ? ? -69.76 5.69 12 11 ASP A 46 ? ? -97.48 -62.11 13 12 PRO A 36 ? ? -69.72 7.20 14 14 PRO A 36 ? ? -69.77 3.67 15 15 THR A 38 ? ? -35.42 -35.63 16 16 SER A 25 ? ? -52.13 106.69 17 16 PRO A 36 ? ? -69.74 2.34 18 17 PRO A 36 ? ? -69.80 10.17 19 19 PRO A 8 ? ? -69.81 99.11 20 19 GLU A 32 ? ? 39.02 31.95 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EBR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EBR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.16 mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02%NaN3; 50uM ZnCl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_details.entry_id 2EBR _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_refine.entry_id 2EBR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntent, P.' 5 refinement CYANA 2.0.17 'Guntent, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 LEU N N N N 110 LEU CA C N S 111 LEU C C N N 112 LEU O O N N 113 LEU CB C N N 114 LEU CG C N N 115 LEU CD1 C N N 116 LEU CD2 C N N 117 LEU OXT O N N 118 LEU H H N N 119 LEU H2 H N N 120 LEU HA H N N 121 LEU HB2 H N N 122 LEU HB3 H N N 123 LEU HG H N N 124 LEU HD11 H N N 125 LEU HD12 H N N 126 LEU HD13 H N N 127 LEU HD21 H N N 128 LEU HD22 H N N 129 LEU HD23 H N N 130 LEU HXT H N N 131 LYS N N N N 132 LYS CA C N S 133 LYS C C N N 134 LYS O O N N 135 LYS CB C N N 136 LYS CG C N N 137 LYS CD C N N 138 LYS CE C N N 139 LYS NZ N N N 140 LYS OXT O N N 141 LYS H H N N 142 LYS H2 H N N 143 LYS HA H N N 144 LYS HB2 H N N 145 LYS HB3 H N N 146 LYS HG2 H N N 147 LYS HG3 H N N 148 LYS HD2 H N N 149 LYS HD3 H N N 150 LYS HE2 H N N 151 LYS HE3 H N N 152 LYS HZ1 H N N 153 LYS HZ2 H N N 154 LYS HZ3 H N N 155 LYS HXT H N N 156 PHE N N N N 157 PHE CA C N S 158 PHE C C N N 159 PHE O O N N 160 PHE CB C N N 161 PHE CG C Y N 162 PHE CD1 C Y N 163 PHE CD2 C Y N 164 PHE CE1 C Y N 165 PHE CE2 C Y N 166 PHE CZ C Y N 167 PHE OXT O N N 168 PHE H H N N 169 PHE H2 H N N 170 PHE HA H N N 171 PHE HB2 H N N 172 PHE HB3 H N N 173 PHE HD1 H N N 174 PHE HD2 H N N 175 PHE HE1 H N N 176 PHE HE2 H N N 177 PHE HZ H N N 178 PHE HXT H N N 179 PRO N N N N 180 PRO CA C N S 181 PRO C C N N 182 PRO O O N N 183 PRO CB C N N 184 PRO CG C N N 185 PRO CD C N N 186 PRO OXT O N N 187 PRO H H N N 188 PRO HA H N N 189 PRO HB2 H N N 190 PRO HB3 H N N 191 PRO HG2 H N N 192 PRO HG3 H N N 193 PRO HD2 H N N 194 PRO HD3 H N N 195 PRO HXT H N N 196 SER N N N N 197 SER CA C N S 198 SER C C N N 199 SER O O N N 200 SER CB C N N 201 SER OG O N N 202 SER OXT O N N 203 SER H H N N 204 SER H2 H N N 205 SER HA H N N 206 SER HB2 H N N 207 SER HB3 H N N 208 SER HG H N N 209 SER HXT H N N 210 THR N N N N 211 THR CA C N S 212 THR C C N N 213 THR O O N N 214 THR CB C N R 215 THR OG1 O N N 216 THR CG2 C N N 217 THR OXT O N N 218 THR H H N N 219 THR H2 H N N 220 THR HA H N N 221 THR HB H N N 222 THR HG1 H N N 223 THR HG21 H N N 224 THR HG22 H N N 225 THR HG23 H N N 226 THR HXT H N N 227 TRP N N N N 228 TRP CA C N S 229 TRP C C N N 230 TRP O O N N 231 TRP CB C N N 232 TRP CG C Y N 233 TRP CD1 C Y N 234 TRP CD2 C Y N 235 TRP NE1 N Y N 236 TRP CE2 C Y N 237 TRP CE3 C Y N 238 TRP CZ2 C Y N 239 TRP CZ3 C Y N 240 TRP CH2 C Y N 241 TRP OXT O N N 242 TRP H H N N 243 TRP H2 H N N 244 TRP HA H N N 245 TRP HB2 H N N 246 TRP HB3 H N N 247 TRP HD1 H N N 248 TRP HE1 H N N 249 TRP HE3 H N N 250 TRP HZ2 H N N 251 TRP HZ3 H N N 252 TRP HH2 H N N 253 TRP HXT H N N 254 VAL N N N N 255 VAL CA C N S 256 VAL C C N N 257 VAL O O N N 258 VAL CB C N N 259 VAL CG1 C N N 260 VAL CG2 C N N 261 VAL OXT O N N 262 VAL H H N N 263 VAL H2 H N N 264 VAL HA H N N 265 VAL HB H N N 266 VAL HG11 H N N 267 VAL HG12 H N N 268 VAL HG13 H N N 269 VAL HG21 H N N 270 VAL HG22 H N N 271 VAL HG23 H N N 272 VAL HXT H N N 273 ZN ZN ZN N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 LEU N CA sing N N 103 LEU N H sing N N 104 LEU N H2 sing N N 105 LEU CA C sing N N 106 LEU CA CB sing N N 107 LEU CA HA sing N N 108 LEU C O doub N N 109 LEU C OXT sing N N 110 LEU CB CG sing N N 111 LEU CB HB2 sing N N 112 LEU CB HB3 sing N N 113 LEU CG CD1 sing N N 114 LEU CG CD2 sing N N 115 LEU CG HG sing N N 116 LEU CD1 HD11 sing N N 117 LEU CD1 HD12 sing N N 118 LEU CD1 HD13 sing N N 119 LEU CD2 HD21 sing N N 120 LEU CD2 HD22 sing N N 121 LEU CD2 HD23 sing N N 122 LEU OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 PHE N CA sing N N 148 PHE N H sing N N 149 PHE N H2 sing N N 150 PHE CA C sing N N 151 PHE CA CB sing N N 152 PHE CA HA sing N N 153 PHE C O doub N N 154 PHE C OXT sing N N 155 PHE CB CG sing N N 156 PHE CB HB2 sing N N 157 PHE CB HB3 sing N N 158 PHE CG CD1 doub Y N 159 PHE CG CD2 sing Y N 160 PHE CD1 CE1 sing Y N 161 PHE CD1 HD1 sing N N 162 PHE CD2 CE2 doub Y N 163 PHE CD2 HD2 sing N N 164 PHE CE1 CZ doub Y N 165 PHE CE1 HE1 sing N N 166 PHE CE2 CZ sing Y N 167 PHE CE2 HE2 sing N N 168 PHE CZ HZ sing N N 169 PHE OXT HXT sing N N 170 PRO N CA sing N N 171 PRO N CD sing N N 172 PRO N H sing N N 173 PRO CA C sing N N 174 PRO CA CB sing N N 175 PRO CA HA sing N N 176 PRO C O doub N N 177 PRO C OXT sing N N 178 PRO CB CG sing N N 179 PRO CB HB2 sing N N 180 PRO CB HB3 sing N N 181 PRO CG CD sing N N 182 PRO CG HG2 sing N N 183 PRO CG HG3 sing N N 184 PRO CD HD2 sing N N 185 PRO CD HD3 sing N N 186 PRO OXT HXT sing N N 187 SER N CA sing N N 188 SER N H sing N N 189 SER N H2 sing N N 190 SER CA C sing N N 191 SER CA CB sing N N 192 SER CA HA sing N N 193 SER C O doub N N 194 SER C OXT sing N N 195 SER CB OG sing N N 196 SER CB HB2 sing N N 197 SER CB HB3 sing N N 198 SER OG HG sing N N 199 SER OXT HXT sing N N 200 THR N CA sing N N 201 THR N H sing N N 202 THR N H2 sing N N 203 THR CA C sing N N 204 THR CA CB sing N N 205 THR CA HA sing N N 206 THR C O doub N N 207 THR C OXT sing N N 208 THR CB OG1 sing N N 209 THR CB CG2 sing N N 210 THR CB HB sing N N 211 THR OG1 HG1 sing N N 212 THR CG2 HG21 sing N N 213 THR CG2 HG22 sing N N 214 THR CG2 HG23 sing N N 215 THR OXT HXT sing N N 216 TRP N CA sing N N 217 TRP N H sing N N 218 TRP N H2 sing N N 219 TRP CA C sing N N 220 TRP CA CB sing N N 221 TRP CA HA sing N N 222 TRP C O doub N N 223 TRP C OXT sing N N 224 TRP CB CG sing N N 225 TRP CB HB2 sing N N 226 TRP CB HB3 sing N N 227 TRP CG CD1 doub Y N 228 TRP CG CD2 sing Y N 229 TRP CD1 NE1 sing Y N 230 TRP CD1 HD1 sing N N 231 TRP CD2 CE2 doub Y N 232 TRP CD2 CE3 sing Y N 233 TRP NE1 CE2 sing Y N 234 TRP NE1 HE1 sing N N 235 TRP CE2 CZ2 sing Y N 236 TRP CE3 CZ3 doub Y N 237 TRP CE3 HE3 sing N N 238 TRP CZ2 CH2 doub Y N 239 TRP CZ2 HZ2 sing N N 240 TRP CZ3 CH2 sing Y N 241 TRP CZ3 HZ3 sing N N 242 TRP CH2 HH2 sing N N 243 TRP OXT HXT sing N N 244 VAL N CA sing N N 245 VAL N H sing N N 246 VAL N H2 sing N N 247 VAL CA C sing N N 248 VAL CA CB sing N N 249 VAL CA HA sing N N 250 VAL C O doub N N 251 VAL C OXT sing N N 252 VAL CB CG1 sing N N 253 VAL CB CG2 sing N N 254 VAL CB HB sing N N 255 VAL CG1 HG11 sing N N 256 VAL CG1 HG12 sing N N 257 VAL CG1 HG13 sing N N 258 VAL CG2 HG21 sing N N 259 VAL CG2 HG22 sing N N 260 VAL CG2 HG23 sing N N 261 VAL OXT HXT sing N N 262 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EBR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #