data_2ECM # _entry.id 2ECM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ECM RCSB RCSB026500 WWPDB D_1000026500 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007120724.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ECM _pdbx_database_status.recvd_initial_deposition_date 2007-02-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Yoneyama, M.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the RING domain of the RING finger and CHY zinc finger domain-containing protein 1 from Mus musculus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Miyamoto, K.' 1 primary 'Yoneyama, M.' 2 primary 'Koshiba, S.' 3 primary 'Watanabe, S.' 4 primary 'Harada, T.' 5 primary 'Kigawa, T.' 6 primary 'Yokoyama, S.' 7 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RING finger and CHY zinc finger domain-containing protein 1' 5839.690 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein 363, CH-rich-interacting match with PLAG1, Androgen receptor N-terminal-interacting protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007120724.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 PRO n 1 10 ILE n 1 11 CYS n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 ILE n 1 16 HIS n 1 17 THR n 1 18 SER n 1 19 ARG n 1 20 VAL n 1 21 VAL n 1 22 ALA n 1 23 HIS n 1 24 VAL n 1 25 LEU n 1 26 PRO n 1 27 CYS n 1 28 GLY n 1 29 HIS n 1 30 LEU n 1 31 LEU n 1 32 HIS n 1 33 ARG n 1 34 THR n 1 35 CYS n 1 36 TYR n 1 37 GLU n 1 38 GLU n 1 39 MET n 1 40 LEU n 1 41 LYS n 1 42 GLU n 1 43 GLY n 1 44 TYR n 1 45 ARG n 1 46 CYS n 1 47 PRO n 1 48 LEU n 1 49 CYS n 1 50 SER n 1 51 GLY n 1 52 PRO n 1 53 SER n 1 54 SER n 1 55 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Rchy1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060911-23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN363_MOUSE _struct_ref.pdbx_db_accession Q9CR50 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLC _struct_ref.pdbx_align_begin 145 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ECM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9CR50 _struct_ref_seq.db_align_beg 145 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 186 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 49 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ECM GLY A 1 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 1 1 1 2ECM SER A 2 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 2 2 1 2ECM SER A 3 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 3 3 1 2ECM GLY A 4 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 4 4 1 2ECM SER A 5 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 5 5 1 2ECM SER A 6 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 6 6 1 2ECM GLY A 7 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 7 7 1 2ECM SER A 50 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 50 8 1 2ECM GLY A 51 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 51 9 1 2ECM PRO A 52 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 52 10 1 2ECM SER A 53 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 53 11 1 2ECM SER A 54 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 54 12 1 2ECM GLY A 55 ? UNP Q9CR50 ? ? 'CLONING ARTIFACT' 55 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.13mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 1.0mM IDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2ECM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ECM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ECM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' Kujira 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2ECM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ECM _struct.title 'Solution structure of the RING domain of the RING finger and CHY zinc finger domain-containing protein 1 from Mus musculus' _struct.pdbx_descriptor 'RING finger and CHY zinc finger domain-containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ECM _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;RING finger and CHY zinc finger domain-containing protein 1, Rchy1, RING domain, zinc-binding domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 34 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 43 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 34 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 43 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 8 SG ? ? A ZN 201 A CYS 8 1_555 ? ? ? ? ? ? ? 2.389 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 11 SG ? ? A ZN 201 A CYS 11 1_555 ? ? ? ? ? ? ? 2.340 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 32 ND1 ? ? A ZN 201 A HIS 32 1_555 ? ? ? ? ? ? ? 1.945 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 35 SG ? ? A ZN 201 A CYS 35 1_555 ? ? ? ? ? ? ? 2.196 ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 27 SG ? ? A ZN 401 A CYS 27 1_555 ? ? ? ? ? ? ? 2.391 ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 29 ND1 ? ? A ZN 401 A HIS 29 1_555 ? ? ? ? ? ? ? 2.097 ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 46 SG ? ? A ZN 401 A CYS 46 1_555 ? ? ? ? ? ? ? 2.212 ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 49 SG ? ? A ZN 401 A CYS 49 1_555 ? ? ? ? ? ? ? 2.216 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 22 ? VAL A 24 ? ALA A 22 VAL A 24 A 2 LEU A 30 ? HIS A 32 ? LEU A 30 HIS A 32 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id HIS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 32 ? HIS A 32 . ? 1_555 ? 4 AC1 4 CYS A 35 ? CYS A 35 . ? 1_555 ? 5 AC2 4 CYS A 27 ? CYS A 27 . ? 1_555 ? 6 AC2 4 HIS A 29 ? HIS A 29 . ? 1_555 ? 7 AC2 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 8 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? # _database_PDB_matrix.entry_id 2ECM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ECM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 99.3 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 32 ? A HIS 32 ? 1_555 100.1 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 32 ? A HIS 32 ? 1_555 101.4 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 109.5 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 117.7 ? 6 ND1 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 124.8 ? 7 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 29 ? A HIS 29 ? 1_555 97.9 ? 8 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 103.0 ? 9 ND1 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 111.6 ? 10 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 104.7 ? 11 ND1 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 114.1 ? 12 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 121.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -81.65 46.05 2 1 CYS A 8 ? ? -53.16 107.79 3 1 ASP A 14 ? ? -37.15 115.33 4 1 PRO A 26 ? ? -69.80 1.86 5 1 ARG A 33 ? ? -34.42 -36.33 6 1 CYS A 46 ? ? -32.46 95.89 7 1 PRO A 47 ? ? -69.74 2.37 8 1 SER A 50 ? ? -35.70 138.71 9 1 PRO A 52 ? ? -69.77 -174.13 10 2 SER A 3 ? ? -86.15 42.14 11 2 SER A 5 ? ? -164.99 107.81 12 2 PRO A 9 ? ? -69.77 4.32 13 2 ILE A 10 ? ? -104.06 -64.55 14 2 THR A 17 ? ? -84.58 39.67 15 2 SER A 18 ? ? -134.18 -41.62 16 2 GLU A 42 ? ? -41.84 -70.16 17 3 ASP A 14 ? ? -34.90 135.41 18 3 PRO A 26 ? ? -69.80 2.51 19 3 CYS A 46 ? ? -34.89 101.38 20 3 PRO A 47 ? ? -69.79 2.39 21 4 PRO A 9 ? ? -69.80 2.92 22 4 ASP A 14 ? ? -38.52 125.49 23 4 THR A 17 ? ? -83.70 30.43 24 4 PRO A 26 ? ? -69.81 2.39 25 4 CYS A 46 ? ? -35.02 114.43 26 4 CYS A 49 ? ? -88.89 44.42 27 4 PRO A 52 ? ? -69.74 85.92 28 5 SER A 2 ? ? -163.52 106.79 29 5 PRO A 9 ? ? -69.77 3.49 30 5 ILE A 10 ? ? -102.71 -61.81 31 5 SER A 18 ? ? -90.58 -72.31 32 5 PRO A 26 ? ? -69.71 2.17 33 5 MET A 39 ? ? -38.51 -39.66 34 5 GLU A 42 ? ? -62.09 -176.11 35 5 CYS A 46 ? ? -33.75 104.66 36 5 PRO A 47 ? ? -69.79 0.51 37 6 SER A 3 ? ? -37.70 119.64 38 6 SER A 6 ? ? -109.90 43.66 39 6 PRO A 9 ? ? -69.75 2.93 40 6 ASP A 14 ? ? -37.22 112.44 41 6 ARG A 19 ? ? -128.26 -65.61 42 6 PRO A 26 ? ? -69.80 2.87 43 6 GLU A 42 ? ? -56.01 -73.18 44 6 TYR A 44 ? ? -172.05 131.68 45 6 CYS A 49 ? ? -88.77 43.88 46 6 PRO A 52 ? ? -69.78 3.06 47 7 SER A 3 ? ? -86.75 42.28 48 7 CYS A 8 ? ? -36.25 117.28 49 7 PRO A 9 ? ? -69.78 3.58 50 7 ILE A 10 ? ? -101.47 -65.82 51 7 ASP A 14 ? ? -34.77 107.62 52 7 ILE A 15 ? ? -65.61 88.33 53 7 ARG A 19 ? ? -131.65 -44.13 54 7 MET A 39 ? ? -38.56 -35.43 55 7 CYS A 46 ? ? -37.74 108.55 56 8 PRO A 9 ? ? -69.78 3.08 57 8 ASP A 14 ? ? -35.41 111.76 58 8 SER A 18 ? ? -94.73 -62.02 59 8 PRO A 26 ? ? -69.75 0.86 60 8 CYS A 46 ? ? -36.78 112.41 61 8 CYS A 49 ? ? -84.82 43.97 62 8 SER A 53 ? ? -34.37 99.74 63 9 PRO A 9 ? ? -69.71 3.73 64 9 ILE A 10 ? ? -100.67 -60.37 65 9 ASP A 14 ? ? -38.75 131.29 66 9 THR A 17 ? ? -84.19 36.75 67 9 SER A 18 ? ? -134.12 -37.56 68 9 PRO A 26 ? ? -69.77 2.50 69 9 ARG A 45 ? ? -101.37 -74.68 70 9 PRO A 52 ? ? -69.69 94.68 71 10 SER A 5 ? ? -50.08 97.36 72 10 PRO A 9 ? ? -69.72 2.81 73 10 ILE A 10 ? ? -101.68 -68.77 74 10 ASP A 14 ? ? -36.05 122.56 75 10 PRO A 26 ? ? -69.77 2.50 76 10 CYS A 46 ? ? -173.28 114.26 77 10 SER A 54 ? ? 39.92 44.01 78 11 PRO A 26 ? ? -69.80 2.59 79 11 GLU A 42 ? ? -43.53 -74.18 80 11 CYS A 46 ? ? -173.05 114.90 81 12 SER A 5 ? ? -54.08 172.94 82 12 ILE A 10 ? ? -95.44 -65.27 83 12 ASP A 14 ? ? -36.38 135.35 84 12 SER A 18 ? ? 38.49 35.78 85 12 ARG A 19 ? ? -129.41 -51.99 86 12 VAL A 24 ? ? -61.40 98.01 87 12 PRO A 52 ? ? -69.74 1.74 88 13 ASP A 14 ? ? -38.00 148.98 89 13 THR A 17 ? ? -125.01 -53.44 90 13 PRO A 26 ? ? -69.79 2.93 91 13 CYS A 46 ? ? -33.46 96.65 92 13 PRO A 47 ? ? -69.79 1.93 93 14 PRO A 9 ? ? -69.73 3.79 94 14 ILE A 10 ? ? -102.23 -64.21 95 14 ARG A 19 ? ? -122.45 -55.45 96 14 PRO A 26 ? ? -69.80 1.88 97 14 GLU A 38 ? ? -79.78 -70.32 98 14 GLU A 42 ? ? -47.54 -71.81 99 14 CYS A 46 ? ? -35.24 103.91 100 14 SER A 50 ? ? -129.43 -57.54 101 14 PRO A 52 ? ? -69.80 3.18 102 14 SER A 53 ? ? -33.21 131.12 103 15 SER A 3 ? ? -48.83 166.75 104 15 PRO A 9 ? ? -69.76 4.47 105 15 PRO A 26 ? ? -69.76 2.87 106 15 ARG A 33 ? ? -34.13 -35.72 107 15 MET A 39 ? ? -38.05 -30.61 108 15 CYS A 46 ? ? -36.93 110.87 109 15 SER A 53 ? ? -40.56 153.29 110 16 ILE A 10 ? ? -90.63 -62.42 111 16 ASP A 14 ? ? -35.00 136.40 112 16 CYS A 46 ? ? -172.90 117.33 113 16 PRO A 52 ? ? -69.69 2.81 114 17 ARG A 19 ? ? -96.43 -67.65 115 17 VAL A 21 ? ? -43.34 151.03 116 17 PRO A 26 ? ? -69.71 1.81 117 17 ARG A 33 ? ? -38.02 -35.56 118 17 CYS A 46 ? ? -165.66 110.17 119 17 CYS A 49 ? ? -83.80 45.83 120 18 SER A 3 ? ? 36.22 42.23 121 18 SER A 6 ? ? -46.64 165.16 122 18 VAL A 21 ? ? -35.61 149.32 123 18 PRO A 26 ? ? -69.75 0.97 124 18 CYS A 46 ? ? -34.43 100.96 125 18 CYS A 49 ? ? -83.28 45.63 126 18 PRO A 52 ? ? -69.82 4.01 127 18 SER A 53 ? ? -32.08 114.05 128 19 SER A 6 ? ? -134.29 -40.40 129 19 PRO A 9 ? ? -69.80 2.88 130 19 ILE A 10 ? ? -100.56 -61.38 131 19 ASP A 14 ? ? -35.39 111.00 132 19 PRO A 26 ? ? -69.73 1.76 133 19 CYS A 46 ? ? -39.81 117.61 134 19 CYS A 49 ? ? -93.10 42.00 135 19 SER A 50 ? ? -38.18 107.29 136 20 PRO A 9 ? ? -69.83 3.48 137 20 ILE A 10 ? ? -103.12 -61.45 138 20 LEU A 12 ? ? 70.65 51.90 139 20 ASP A 14 ? ? -35.83 129.14 140 20 THR A 17 ? ? -82.78 36.75 141 20 SER A 18 ? ? -132.12 -47.28 142 20 PRO A 26 ? ? -69.82 3.41 143 20 GLU A 42 ? ? -37.40 -74.50 144 20 SER A 53 ? ? -53.23 85.36 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #