data_2ECN # _entry.id 2ECN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ECN pdb_00002ecn 10.2210/pdb2ecn/pdb RCSB RCSB026501 ? ? WWPDB D_1000026501 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002011058.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ECN _pdbx_database_status.recvd_initial_deposition_date 2007-02-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the RING domain of the human RING finger protein 141' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RING finger protein 141' 7574.540 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein 230' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002011058.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 VAL n 1 10 LYS n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 ASP n 1 15 GLU n 1 16 GLU n 1 17 GLU n 1 18 CYS n 1 19 CYS n 1 20 ILE n 1 21 CYS n 1 22 MET n 1 23 ASP n 1 24 GLY n 1 25 ARG n 1 26 ALA n 1 27 ASP n 1 28 LEU n 1 29 ILE n 1 30 LEU n 1 31 PRO n 1 32 CYS n 1 33 ALA n 1 34 HIS n 1 35 SER n 1 36 PHE n 1 37 CYS n 1 38 GLN n 1 39 LYS n 1 40 CYS n 1 41 ILE n 1 42 ASP n 1 43 LYS n 1 44 TRP n 1 45 SER n 1 46 ASP n 1 47 ARG n 1 48 HIS n 1 49 ARG n 1 50 ASN n 1 51 CYS n 1 52 PRO n 1 53 ILE n 1 54 CYS n 1 55 ARG n 1 56 LEU n 1 57 GLN n 1 58 MET n 1 59 THR n 1 60 GLY n 1 61 ALA n 1 62 ASN n 1 63 GLU n 1 64 SER n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RNF141, ZNF230' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060919-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN141_HUMAN _struct_ref.pdbx_db_accession Q8WVD5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANES _struct_ref.pdbx_align_begin 145 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ECN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WVD5 _struct_ref_seq.db_align_beg 145 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ECN GLY A 1 ? UNP Q8WVD5 ? ? 'cloning artifact' 1 1 1 2ECN SER A 2 ? UNP Q8WVD5 ? ? 'cloning artifact' 2 2 1 2ECN SER A 3 ? UNP Q8WVD5 ? ? 'cloning artifact' 3 3 1 2ECN GLY A 4 ? UNP Q8WVD5 ? ? 'cloning artifact' 4 4 1 2ECN SER A 5 ? UNP Q8WVD5 ? ? 'cloning artifact' 5 5 1 2ECN SER A 6 ? UNP Q8WVD5 ? ? 'cloning artifact' 6 6 1 2ECN GLY A 7 ? UNP Q8WVD5 ? ? 'cloning artifact' 7 7 1 2ECN SER A 65 ? UNP Q8WVD5 ? ? 'cloning artifact' 65 8 1 2ECN GLY A 66 ? UNP Q8WVD5 ? ? 'cloning artifact' 66 9 1 2ECN PRO A 67 ? UNP Q8WVD5 ? ? 'cloning artifact' 67 10 1 2ECN SER A 68 ? UNP Q8WVD5 ? ? 'cloning artifact' 68 11 1 2ECN SER A 69 ? UNP Q8WVD5 ? ? 'cloning artifact' 69 12 1 2ECN GLY A 70 ? UNP Q8WVD5 ? ? 'cloning artifact' 70 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.31mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 1.0mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2ECN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ECN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ECN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2ECN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ECN _struct.title 'Solution structure of the RING domain of the human RING finger protein 141' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ECN _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;RING finger protein 141, RNF141, RING domain, zinc-binding domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 37 ? TRP A 44 ? CYS A 37 TRP A 44 1 ? 8 HELX_P HELX_P2 2 CYS A 51 ? GLN A 57 ? CYS A 51 GLN A 57 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc3 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.381 ? ? metalc4 metalc ? ? A HIS 34 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc5 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 201 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc6 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 40 A ZN 201 1_555 ? ? ? ? ? ? ? 2.268 ? ? metalc7 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 51 A ZN 401 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc8 metalc ? ? A CYS 54 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 54 A ZN 401 1_555 ? ? ? ? ? ? ? 2.302 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 28 ? LEU A 30 ? LEU A 28 LEU A 30 A 2 HIS A 34 ? PHE A 36 ? HIS A 34 PHE A 36 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 30 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 30 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id HIS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 34 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 34 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 4 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 6 AC2 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 7 AC2 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 8 AC2 4 CYS A 54 ? CYS A 54 . ? 1_555 ? # _database_PDB_matrix.entry_id 2ECN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ECN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 105.3 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 117.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 104.7 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 112.3 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 113.2 ? 6 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 104.1 ? 7 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 102.6 ? 8 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 108.9 ? 9 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 106.9 ? 10 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 104.8 ? 11 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 109.6 ? 12 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 122.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.pdbx_dist_value' 6 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 3 'Structure model' '_struct_ref_seq_dif.details' 19 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -100.32 42.04 2 1 CYS A 18 ? ? -41.84 156.72 3 1 PRO A 31 ? ? -69.80 2.92 4 1 TRP A 44 ? ? -67.32 98.25 5 1 SER A 65 ? ? -120.67 -57.33 6 2 CYS A 18 ? ? -41.05 161.31 7 2 PRO A 31 ? ? -69.69 1.69 8 2 ARG A 47 ? ? -95.21 40.79 9 2 ARG A 49 ? ? -98.17 42.96 10 3 SER A 2 ? ? -163.60 115.85 11 3 LYS A 10 ? ? -109.87 75.59 12 3 LEU A 12 ? ? -86.84 39.70 13 3 ASP A 23 ? ? -120.32 -59.52 14 3 PRO A 31 ? ? -69.79 0.31 15 3 HIS A 48 ? ? -108.00 -66.31 16 3 ASN A 50 ? ? -38.64 154.08 17 3 GLN A 57 ? ? -69.65 87.29 18 3 ALA A 61 ? ? -48.96 157.40 19 3 PRO A 67 ? ? -69.75 -178.68 20 3 SER A 68 ? ? -166.85 117.29 21 4 LEU A 12 ? ? -51.98 108.02 22 4 GLU A 16 ? ? -39.50 158.38 23 4 CYS A 18 ? ? -45.84 162.04 24 4 MET A 22 ? ? 34.93 32.36 25 4 ARG A 25 ? ? -37.25 155.35 26 4 GLU A 63 ? ? -55.77 106.88 27 4 SER A 64 ? ? -163.11 115.48 28 4 PRO A 67 ? ? -69.79 86.81 29 5 LYS A 10 ? ? -80.83 43.19 30 5 THR A 13 ? ? -174.87 129.32 31 5 CYS A 18 ? ? -43.70 159.36 32 5 MET A 22 ? ? 37.75 35.18 33 5 ALA A 33 ? ? 71.76 43.90 34 6 GLU A 15 ? ? -84.30 35.09 35 6 ILE A 20 ? ? -64.73 -71.72 36 6 MET A 22 ? ? 38.75 32.73 37 6 PRO A 31 ? ? -69.72 2.56 38 6 ALA A 33 ? ? 71.44 39.88 39 6 ILE A 53 ? ? -95.32 -63.29 40 7 SER A 5 ? ? -39.43 105.08 41 7 SER A 6 ? ? -91.15 42.08 42 7 ASP A 14 ? ? -47.84 159.38 43 7 GLU A 17 ? ? -174.66 142.17 44 7 CYS A 18 ? ? -42.21 158.36 45 7 PRO A 31 ? ? -69.71 0.07 46 7 HIS A 48 ? ? -160.54 116.63 47 7 ARG A 49 ? ? -38.53 -33.57 48 7 ALA A 61 ? ? -48.25 167.43 49 7 PRO A 67 ? ? -69.76 3.03 50 7 SER A 68 ? ? -34.92 136.77 51 8 ILE A 20 ? ? -68.97 -72.15 52 8 MET A 22 ? ? 34.84 45.78 53 8 PRO A 31 ? ? -69.67 1.61 54 8 SER A 45 ? ? -35.09 138.77 55 8 ASP A 46 ? ? -95.22 40.10 56 8 PRO A 67 ? ? -69.75 0.96 57 9 SER A 5 ? ? -174.67 111.55 58 9 GLN A 11 ? ? 34.44 43.43 59 9 CYS A 18 ? ? -48.91 155.29 60 9 ASP A 23 ? ? -68.51 -72.68 61 9 PRO A 31 ? ? -69.77 2.97 62 9 ARG A 49 ? ? -93.07 33.06 63 9 THR A 59 ? ? -39.79 157.32 64 9 GLU A 63 ? ? -39.69 154.24 65 10 THR A 13 ? ? -83.13 44.57 66 10 GLU A 15 ? ? 33.44 34.24 67 10 GLU A 17 ? ? -174.99 136.80 68 10 CYS A 18 ? ? -47.16 160.77 69 10 MET A 22 ? ? 35.57 53.09 70 10 PRO A 31 ? ? -69.74 1.11 71 10 ASN A 50 ? ? -48.66 157.70 72 10 GLN A 57 ? ? -34.38 104.18 73 10 MET A 58 ? ? -44.48 161.78 74 10 GLU A 63 ? ? -88.69 41.36 75 10 SER A 68 ? ? -35.31 108.69 76 11 GLU A 17 ? ? -174.14 137.73 77 11 PRO A 31 ? ? -69.81 2.45 78 11 GLN A 57 ? ? -34.60 110.88 79 11 SER A 65 ? ? -37.59 155.89 80 12 SER A 6 ? ? 35.94 37.92 81 12 LYS A 10 ? ? -118.74 74.40 82 12 CYS A 18 ? ? -44.53 162.46 83 12 PRO A 31 ? ? -69.80 2.74 84 12 TRP A 44 ? ? -88.78 42.02 85 12 ASP A 46 ? ? -63.98 98.72 86 13 GLN A 11 ? ? -103.47 42.58 87 13 CYS A 18 ? ? -42.72 159.19 88 13 SER A 45 ? ? 72.39 43.86 89 13 GLN A 57 ? ? -57.93 105.81 90 13 THR A 59 ? ? 36.11 38.03 91 14 LYS A 10 ? ? -111.07 55.91 92 14 THR A 13 ? ? -170.11 129.10 93 14 GLU A 17 ? ? -174.70 147.75 94 14 CYS A 18 ? ? -44.61 165.95 95 14 ASP A 23 ? ? -82.89 -71.66 96 14 ARG A 25 ? ? -57.29 -178.56 97 14 PRO A 31 ? ? -69.72 3.08 98 14 HIS A 48 ? ? -169.50 110.77 99 14 GLN A 57 ? ? -33.93 93.58 100 14 MET A 58 ? ? 35.88 49.12 101 14 PRO A 67 ? ? -69.73 2.88 102 15 ARG A 8 ? ? -170.43 105.49 103 15 GLU A 16 ? ? -48.29 156.84 104 15 MET A 22 ? ? 39.56 33.39 105 15 PRO A 31 ? ? -69.72 2.11 106 15 ASP A 46 ? ? -41.16 103.97 107 15 HIS A 48 ? ? -50.35 178.68 108 15 ARG A 49 ? ? -84.27 46.92 109 15 ALA A 61 ? ? -173.13 138.12 110 16 SER A 2 ? ? -34.86 139.05 111 16 THR A 13 ? ? -174.14 130.30 112 16 GLU A 17 ? ? -173.59 147.59 113 16 PRO A 31 ? ? -69.70 3.00 114 17 SER A 3 ? ? -171.33 117.05 115 17 SER A 5 ? ? -84.58 42.07 116 17 ARG A 8 ? ? -100.78 43.71 117 17 THR A 13 ? ? -171.70 127.85 118 17 PRO A 31 ? ? -69.74 1.08 119 17 ARG A 47 ? ? -128.86 -53.24 120 17 GLN A 57 ? ? -45.09 95.36 121 17 SER A 69 ? ? -36.68 133.58 122 18 VAL A 9 ? ? -37.49 132.97 123 18 CYS A 18 ? ? -44.29 158.53 124 18 MET A 22 ? ? 39.86 29.16 125 18 ASP A 23 ? ? -108.52 46.42 126 18 PRO A 31 ? ? -69.71 2.65 127 18 SER A 45 ? ? -80.80 43.85 128 18 ARG A 49 ? ? -92.91 43.03 129 18 GLN A 57 ? ? -65.25 96.92 130 19 PRO A 31 ? ? -69.81 2.56 131 19 HIS A 48 ? ? -43.52 165.71 132 19 ARG A 49 ? ? -83.39 44.27 133 19 GLN A 57 ? ? -104.92 56.40 134 19 THR A 59 ? ? -43.40 162.11 135 19 ALA A 61 ? ? -49.40 152.34 136 19 SER A 69 ? ? -60.58 93.75 137 20 ILE A 20 ? ? -61.40 -74.04 138 20 PRO A 31 ? ? -69.73 3.32 139 20 ALA A 33 ? ? 71.14 31.92 140 20 ASP A 46 ? ? -91.08 41.24 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #