data_2ED0 # _entry.id 2ED0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ED0 pdb_00002ed0 10.2210/pdb2ed0/pdb RCSB RCSB026513 ? ? WWPDB D_1000026513 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002003990.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ED0 _pdbx_database_status.recvd_initial_deposition_date 2007-02-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, H.' 1 'Tochio, N.' 2 'Miyamoto, K.' 3 'Saito, K.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, H.' 1 ? primary 'Tochio, N.' 2 ? primary 'Miyamoto, K.' 3 ? primary 'Saito, K.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Abl interactor 2' _entity.formula_weight 8433.171 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Abelson interactor 2, Abi-2, Abl-binding protein 3, AblBP3, Arg-binding protein 1, ArgBP1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002003990.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASP n 1 9 PRO n 1 10 PRO n 1 11 TRP n 1 12 ALA n 1 13 PRO n 1 14 ARG n 1 15 SER n 1 16 TYR n 1 17 LEU n 1 18 GLU n 1 19 LYS n 1 20 VAL n 1 21 VAL n 1 22 ALA n 1 23 ILE n 1 24 TYR n 1 25 ASP n 1 26 TYR n 1 27 THR n 1 28 LYS n 1 29 ASP n 1 30 LYS n 1 31 GLU n 1 32 ASP n 1 33 GLU n 1 34 LEU n 1 35 SER n 1 36 PHE n 1 37 GLN n 1 38 GLU n 1 39 GLY n 1 40 ALA n 1 41 ILE n 1 42 ILE n 1 43 TYR n 1 44 VAL n 1 45 ILE n 1 46 LYS n 1 47 LYS n 1 48 ASN n 1 49 ASP n 1 50 ASP n 1 51 GLY n 1 52 TRP n 1 53 TYR n 1 54 GLU n 1 55 GLY n 1 56 VAL n 1 57 MET n 1 58 ASN n 1 59 GLY n 1 60 VAL n 1 61 THR n 1 62 GLY n 1 63 LEU n 1 64 PHE n 1 65 PRO n 1 66 GLY n 1 67 ASN n 1 68 TYR n 1 69 VAL n 1 70 GLU n 1 71 SER n 1 72 ILE n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ABI2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050704-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABI2_HUMAN _struct_ref.pdbx_db_accession Q9NYB9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI _struct_ref.pdbx_align_begin 444 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ED0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NYB9 _struct_ref_seq.db_align_beg 444 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 508 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ED0 GLY A 1 ? UNP Q9NYB9 ? ? 'expression tag' 1 1 1 2ED0 SER A 2 ? UNP Q9NYB9 ? ? 'expression tag' 2 2 1 2ED0 SER A 3 ? UNP Q9NYB9 ? ? 'expression tag' 3 3 1 2ED0 GLY A 4 ? UNP Q9NYB9 ? ? 'expression tag' 4 4 1 2ED0 SER A 5 ? UNP Q9NYB9 ? ? 'expression tag' 5 5 1 2ED0 SER A 6 ? UNP Q9NYB9 ? ? 'expression tag' 6 6 1 2ED0 GLY A 7 ? UNP Q9NYB9 ? ? 'expression tag' 7 7 1 2ED0 SER A 73 ? UNP Q9NYB9 ? ? 'expression tag' 73 8 1 2ED0 GLY A 74 ? UNP Q9NYB9 ? ? 'expression tag' 74 9 1 2ED0 PRO A 75 ? UNP Q9NYB9 ? ? 'expression tag' 75 10 1 2ED0 SER A 76 ? UNP Q9NYB9 ? ? 'expression tag' 76 11 1 2ED0 SER A 77 ? UNP Q9NYB9 ? ? 'expression tag' 77 12 1 2ED0 GLY A 78 ? UNP Q9NYB9 ? ? 'expression tag' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 4D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.73mM Protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2ED0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ED0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ED0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.A.' 3 'structure solution' CYANA 2.0.17 'Guntert, P.' 4 refinement CYANA 2.0.17 'Guntert, P.' 5 # _exptl.entry_id 2ED0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ED0 _struct.title 'Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ED0 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;Coiled coil, Cytoskeleton, Nuclear protein, Phosphorylation, SH3 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 60 ? PRO A 65 ? VAL A 60 PRO A 65 A 2 TRP A 52 ? MET A 57 ? TRP A 52 MET A 57 A 3 ILE A 41 ? LYS A 47 ? ILE A 41 LYS A 47 A 4 GLU A 18 ? ALA A 22 ? GLU A 18 ALA A 22 A 5 VAL A 69 ? SER A 71 ? VAL A 69 SER A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 60 ? O VAL A 60 N MET A 57 ? N MET A 57 A 2 3 O GLU A 54 ? O GLU A 54 N ILE A 45 ? N ILE A 45 A 3 4 O ILE A 42 ? O ILE A 42 N VAL A 20 ? N VAL A 20 A 4 5 N VAL A 21 ? N VAL A 21 O GLU A 70 ? O GLU A 70 # _database_PDB_matrix.entry_id 2ED0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ED0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 38 ? ? -51.62 96.84 2 1 ASN A 67 ? ? -130.42 -37.97 3 2 ASP A 8 ? ? -48.27 154.22 4 2 ASP A 32 ? ? -90.94 38.54 5 3 ASP A 32 ? ? -95.94 54.38 6 3 ASN A 48 ? ? -83.55 38.81 7 3 ASP A 49 ? ? 36.67 32.08 8 3 TRP A 52 ? ? -162.87 106.97 9 3 PRO A 75 ? ? -69.80 1.58 10 3 SER A 77 ? ? -37.04 116.16 11 4 LEU A 17 ? ? -57.14 -71.68 12 4 LYS A 28 ? ? -36.15 128.99 13 4 GLU A 38 ? ? -46.42 152.35 14 5 ASP A 32 ? ? -93.45 47.35 15 5 GLU A 38 ? ? -52.64 108.29 16 5 ASN A 58 ? ? 39.97 38.07 17 5 TYR A 68 ? ? -38.52 -31.71 18 6 SER A 6 ? ? -130.17 -44.93 19 6 LYS A 28 ? ? -36.84 122.27 20 6 ASP A 50 ? ? -99.45 40.39 21 6 ASN A 58 ? ? 35.78 37.79 22 7 SER A 5 ? ? -35.06 104.48 23 7 LYS A 28 ? ? -35.57 133.18 24 7 ASP A 32 ? ? -76.20 49.10 25 7 GLU A 38 ? ? -39.62 110.57 26 7 TRP A 52 ? ? -34.46 137.96 27 8 ASP A 49 ? ? -76.38 48.36 28 9 GLU A 38 ? ? -52.81 109.07 29 9 TYR A 68 ? ? -97.83 35.32 30 10 GLU A 31 ? ? -83.33 36.64 31 10 SER A 77 ? ? -55.18 100.68 32 11 SER A 2 ? ? -89.55 42.43 33 11 SER A 5 ? ? -51.84 177.20 34 11 PRO A 10 ? ? -69.73 2.87 35 11 VAL A 44 ? ? -64.25 95.39 36 11 TYR A 68 ? ? -94.59 32.60 37 11 PRO A 75 ? ? -69.66 1.21 38 11 SER A 77 ? ? -69.22 87.50 39 12 SER A 6 ? ? -47.66 165.56 40 12 GLU A 38 ? ? -51.83 106.23 41 12 TRP A 52 ? ? -162.33 115.16 42 12 TYR A 68 ? ? -36.37 -33.99 43 13 SER A 5 ? ? -131.72 -51.90 44 13 LYS A 28 ? ? -43.67 157.70 45 13 GLU A 38 ? ? -36.69 104.35 46 13 ASP A 49 ? ? -38.34 -39.28 47 14 LYS A 28 ? ? -43.94 150.28 48 14 ASP A 32 ? ? -89.21 43.23 49 14 PRO A 75 ? ? -69.73 99.14 50 15 ARG A 14 ? ? -87.06 36.05 51 15 SER A 15 ? ? -171.51 105.99 52 15 ASP A 32 ? ? -94.03 47.86 53 15 GLU A 38 ? ? -57.97 109.55 54 15 TRP A 52 ? ? -163.34 119.76 55 16 SER A 2 ? ? -165.59 110.57 56 16 GLU A 38 ? ? -43.86 109.35 57 16 ASP A 50 ? ? -95.34 39.29 58 17 LYS A 28 ? ? -48.68 151.05 59 17 GLU A 38 ? ? -43.08 99.19 60 18 ASP A 32 ? ? -86.76 42.97 61 18 GLU A 38 ? ? -50.47 108.01 62 18 SER A 71 ? ? -64.35 82.35 63 18 PRO A 75 ? ? -69.67 85.40 64 19 ALA A 12 ? ? -47.39 153.10 65 19 GLU A 38 ? ? -38.22 123.79 66 19 SER A 76 ? ? 37.91 43.09 67 20 GLU A 31 ? ? -99.58 34.37 68 20 GLU A 33 ? ? -68.85 -175.02 69 20 ASN A 58 ? ? 38.24 46.12 #