data_2EDV # _entry.id 2EDV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EDV pdb_00002edv 10.2210/pdb2edv/pdb RCSB RCSB026542 ? ? WWPDB D_1000026542 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000944.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EDV _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Seimiya, K.' 1 'Kurosaki, C.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the PDZ domain from human FERM and PDZ domain containing 1' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Seimiya, K.' 1 ? primary 'Kurosaki, C.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FERM and PDZ domain-containing protein 1' _entity.formula_weight 10108.138 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDS LSITVVRCTSSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDS LSITVVRCTSSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000944.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 ARG n 1 10 HIS n 1 11 THR n 1 12 VAL n 1 13 LYS n 1 14 ILE n 1 15 ASP n 1 16 LYS n 1 17 ASP n 1 18 THR n 1 19 LEU n 1 20 LEU n 1 21 GLN n 1 22 ASP n 1 23 TYR n 1 24 GLY n 1 25 PHE n 1 26 HIS n 1 27 ILE n 1 28 SER n 1 29 GLU n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 LEU n 1 34 THR n 1 35 VAL n 1 36 VAL n 1 37 ALA n 1 38 VAL n 1 39 THR n 1 40 ALA n 1 41 GLY n 1 42 GLY n 1 43 SER n 1 44 ALA n 1 45 HIS n 1 46 GLY n 1 47 LYS n 1 48 LEU n 1 49 PHE n 1 50 PRO n 1 51 GLY n 1 52 ASP n 1 53 GLN n 1 54 ILE n 1 55 LEU n 1 56 GLN n 1 57 MET n 1 58 ASN n 1 59 ASN n 1 60 GLU n 1 61 PRO n 1 62 ALA n 1 63 GLU n 1 64 ASP n 1 65 LEU n 1 66 SER n 1 67 TRP n 1 68 GLU n 1 69 ARG n 1 70 ALA n 1 71 VAL n 1 72 ASP n 1 73 ILE n 1 74 LEU n 1 75 ARG n 1 76 GLU n 1 77 ALA n 1 78 GLU n 1 79 ASP n 1 80 SER n 1 81 LEU n 1 82 SER n 1 83 ILE n 1 84 THR n 1 85 VAL n 1 86 VAL n 1 87 ARG n 1 88 CYS n 1 89 THR n 1 90 SER n 1 91 SER n 1 92 GLY n 1 93 PRO n 1 94 SER n 1 95 SER n 1 96 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FRMPD1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050711-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q14C73_HUMAN _struct_ref.pdbx_db_accession Q14C73 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVR CTS ; _struct_ref.pdbx_align_begin 54 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EDV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14C73 _struct_ref_seq.db_align_beg 54 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 136 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EDV GLY A 1 ? UNP Q14C73 ? ? 'cloning artifact' 1 1 1 2EDV SER A 2 ? UNP Q14C73 ? ? 'cloning artifact' 2 2 1 2EDV SER A 3 ? UNP Q14C73 ? ? 'cloning artifact' 3 3 1 2EDV GLY A 4 ? UNP Q14C73 ? ? 'cloning artifact' 4 4 1 2EDV SER A 5 ? UNP Q14C73 ? ? 'cloning artifact' 5 5 1 2EDV SER A 6 ? UNP Q14C73 ? ? 'cloning artifact' 6 6 1 2EDV GLY A 7 ? UNP Q14C73 ? ? 'cloning artifact' 7 7 1 2EDV SER A 91 ? UNP Q14C73 ? ? 'cloning artifact' 91 8 1 2EDV GLY A 92 ? UNP Q14C73 ? ? 'cloning artifact' 92 9 1 2EDV PRO A 93 ? UNP Q14C73 ? ? 'cloning artifact' 93 10 1 2EDV SER A 94 ? UNP Q14C73 ? ? 'cloning artifact' 94 11 1 2EDV SER A 95 ? UNP Q14C73 ? ? 'cloning artifact' 95 12 1 2EDV GLY A 96 ? UNP Q14C73 ? ? 'cloning artifact' 96 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.16mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 90% H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_ensemble.entry_id 2EDV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EDV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3.2 JEOL 1 processing NMRPipe 20031121 'Delaglio, F' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EDV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EDV _struct.title 'Solution structure of the PDZ domain from human FERM and PDZ domain containing 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EDV _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;cytoskeletal-associated protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 77 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 66 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 77 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 8 ? ILE A 14 ? VAL A 8 ILE A 14 A 2 LEU A 81 ? ARG A 87 ? LEU A 81 ARG A 87 A 3 ILE A 54 ? MET A 57 ? ILE A 54 MET A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 10 ? N HIS A 10 O VAL A 85 ? O VAL A 85 A 2 3 O THR A 84 ? O THR A 84 N LEU A 55 ? N LEU A 55 # _database_PDB_matrix.entry_id 2EDV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EDV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -39.33 139.95 2 1 GLN A 21 ? ? 36.74 47.61 3 1 TYR A 23 ? ? -84.31 32.81 4 1 PRO A 32 ? ? -69.77 81.19 5 1 ALA A 77 ? ? -49.72 104.46 6 1 SER A 90 ? ? -65.98 94.11 7 2 SER A 3 ? ? -168.12 110.98 8 2 PRO A 32 ? ? -69.73 80.82 9 2 PRO A 50 ? ? -69.76 98.61 10 2 ASN A 59 ? ? 73.21 48.79 11 2 GLU A 68 ? ? -39.41 -38.67 12 3 PRO A 32 ? ? -69.72 80.68 13 3 HIS A 45 ? ? -45.10 105.12 14 3 PRO A 50 ? ? -69.72 90.88 15 4 GLN A 21 ? ? 34.64 48.68 16 4 PRO A 32 ? ? -69.73 80.53 17 4 HIS A 45 ? ? -34.43 119.17 18 4 PRO A 50 ? ? -69.79 93.67 19 4 ASN A 59 ? ? 71.08 36.23 20 4 GLU A 78 ? ? -122.85 -53.29 21 4 PRO A 93 ? ? -69.76 93.21 22 4 SER A 95 ? ? -57.03 96.50 23 5 GLN A 21 ? ? 37.25 29.67 24 5 TYR A 23 ? ? -86.63 33.73 25 5 PRO A 32 ? ? -69.75 81.20 26 5 ALA A 44 ? ? -95.82 31.14 27 5 ASP A 79 ? ? -57.20 -72.59 28 5 SER A 94 ? ? -39.65 152.84 29 6 PRO A 32 ? ? -69.76 80.16 30 6 ALA A 77 ? ? -34.67 120.16 31 7 ASP A 17 ? ? -36.21 135.67 32 7 PRO A 32 ? ? -69.70 80.61 33 7 VAL A 35 ? ? -41.90 107.59 34 7 PRO A 50 ? ? -69.81 94.19 35 8 GLN A 21 ? ? 35.63 38.17 36 8 PRO A 32 ? ? -69.76 81.23 37 8 VAL A 35 ? ? -59.30 94.13 38 8 ALA A 44 ? ? -96.45 30.59 39 8 PRO A 50 ? ? -69.67 96.01 40 8 ASN A 59 ? ? 70.36 46.72 41 8 ASP A 79 ? ? -91.09 -61.73 42 9 SER A 6 ? ? -60.22 96.18 43 9 PRO A 32 ? ? -69.80 80.81 44 9 LEU A 33 ? ? -52.29 101.71 45 9 ALA A 77 ? ? -58.11 106.31 46 10 SER A 2 ? ? -89.70 42.40 47 10 GLN A 21 ? ? 35.91 45.54 48 10 PRO A 32 ? ? -69.72 81.22 49 10 VAL A 35 ? ? -54.27 102.98 50 10 PRO A 50 ? ? -69.81 94.65 51 10 ALA A 77 ? ? -37.51 112.18 52 10 CYS A 88 ? ? -35.38 134.95 53 10 PRO A 93 ? ? -69.81 96.08 54 11 SER A 6 ? ? -45.49 99.42 55 11 ASP A 17 ? ? -47.45 151.94 56 11 GLN A 21 ? ? 38.39 35.56 57 11 PRO A 32 ? ? -69.74 80.04 58 11 LEU A 33 ? ? -39.94 128.12 59 11 VAL A 35 ? ? -48.81 109.43 60 11 THR A 39 ? ? -44.85 164.34 61 11 HIS A 45 ? ? -34.44 120.03 62 12 GLN A 21 ? ? 39.00 46.88 63 12 PRO A 32 ? ? -69.74 80.83 64 12 ALA A 77 ? ? -35.63 115.00 65 12 SER A 94 ? ? -47.89 172.53 66 12 SER A 95 ? ? -126.34 -54.32 67 13 SER A 5 ? ? -170.23 140.21 68 13 GLN A 21 ? ? 37.57 43.94 69 13 PRO A 32 ? ? -69.74 81.04 70 13 LEU A 33 ? ? -52.96 106.05 71 13 VAL A 35 ? ? -52.84 105.70 72 13 PRO A 93 ? ? -69.76 90.64 73 14 PRO A 32 ? ? -69.76 80.36 74 14 LEU A 33 ? ? -37.76 136.08 75 14 HIS A 45 ? ? -38.15 115.57 76 14 PRO A 50 ? ? -69.75 99.94 77 14 ASN A 59 ? ? 70.61 46.17 78 14 GLU A 78 ? ? -130.58 -49.05 79 14 SER A 82 ? ? -101.83 72.56 80 14 SER A 90 ? ? -171.76 144.19 81 14 SER A 95 ? ? -170.50 123.24 82 15 LYS A 16 ? ? -48.02 100.30 83 15 GLN A 21 ? ? 39.15 52.66 84 15 PRO A 32 ? ? -69.80 80.40 85 15 VAL A 35 ? ? -47.43 109.38 86 15 ASN A 59 ? ? 70.28 47.52 87 15 TRP A 67 ? ? -38.22 -35.26 88 15 PRO A 93 ? ? -69.82 1.72 89 16 GLN A 21 ? ? 36.80 33.53 90 16 PRO A 32 ? ? -69.74 81.11 91 16 THR A 39 ? ? -37.71 153.40 92 16 PRO A 50 ? ? -69.77 95.15 93 16 ALA A 77 ? ? -38.04 128.29 94 16 THR A 89 ? ? -36.73 141.64 95 16 PRO A 93 ? ? -69.73 92.28 96 16 SER A 95 ? ? 35.45 49.82 97 17 SER A 6 ? ? -91.39 38.78 98 17 ASP A 17 ? ? -38.79 156.23 99 17 PRO A 32 ? ? -69.68 80.21 100 17 LEU A 33 ? ? -38.97 131.15 101 17 ALA A 40 ? ? -65.05 94.54 102 17 PRO A 50 ? ? -69.84 97.87 103 17 GLU A 78 ? ? -121.08 -67.24 104 17 SER A 82 ? ? -59.88 88.49 105 17 SER A 90 ? ? 37.84 44.84 106 17 PRO A 93 ? ? -69.76 88.31 107 18 GLN A 21 ? ? 37.24 42.92 108 18 PRO A 32 ? ? -69.79 81.29 109 18 ALA A 77 ? ? -37.38 110.58 110 18 GLU A 78 ? ? -88.58 -72.92 111 18 SER A 82 ? ? -56.38 86.94 112 18 PRO A 93 ? ? -69.83 1.96 113 19 PRO A 32 ? ? -69.79 80.21 114 19 ALA A 40 ? ? -76.02 -72.29 115 19 ALA A 44 ? ? -99.98 33.52 116 19 SER A 91 ? ? -40.33 106.00 117 19 SER A 94 ? ? -55.71 108.00 118 20 PRO A 32 ? ? -69.77 80.78 119 20 ALA A 77 ? ? -35.52 101.76 120 20 SER A 94 ? ? -49.35 152.41 #