data_2EE0 # _entry.id 2EE0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EE0 pdb_00002ee0 10.2210/pdb2ee0/pdb RCSB RCSB026547 ? ? WWPDB D_1000026547 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000214.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EE0 _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sato, M.' 1 ? 'Koshiba, S.' 2 ? 'Watanabe, S.' 3 ? 'Harada, T.' 4 ? 'Kigawa, T.' 5 ? 'Yokoyama, S.' 6 ? 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 ? # _citation.id primary _citation.title 'Solution structures of the CA domain of human protocadherin 9' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Protocadherin-9 _entity.formula_weight 11968.174 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CA domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL DREETAIHKVTVLASDGSSTPARATVTINVTDVN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL DREETAIHKVTVLASDGSSTPARATVTINVTDVN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000214.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 ASP n 1 10 ASN n 1 11 ARG n 1 12 PRO n 1 13 VAL n 1 14 PHE n 1 15 LYS n 1 16 GLU n 1 17 GLY n 1 18 GLN n 1 19 VAL n 1 20 GLU n 1 21 VAL n 1 22 HIS n 1 23 ILE n 1 24 PRO n 1 25 GLU n 1 26 ASN n 1 27 ALA n 1 28 PRO n 1 29 VAL n 1 30 GLY n 1 31 THR n 1 32 SER n 1 33 VAL n 1 34 ILE n 1 35 GLN n 1 36 LEU n 1 37 HIS n 1 38 ALA n 1 39 THR n 1 40 ASP n 1 41 ALA n 1 42 ASP n 1 43 ILE n 1 44 GLY n 1 45 SER n 1 46 ASN n 1 47 ALA n 1 48 GLU n 1 49 ILE n 1 50 ARG n 1 51 TYR n 1 52 ILE n 1 53 PHE n 1 54 GLY n 1 55 ALA n 1 56 GLN n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 ALA n 1 61 THR n 1 62 LYS n 1 63 ARG n 1 64 LEU n 1 65 PHE n 1 66 ALA n 1 67 LEU n 1 68 ASN n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 GLY n 1 73 LEU n 1 74 ILE n 1 75 THR n 1 76 VAL n 1 77 GLN n 1 78 ARG n 1 79 SER n 1 80 LEU n 1 81 ASP n 1 82 ARG n 1 83 GLU n 1 84 GLU n 1 85 THR n 1 86 ALA n 1 87 ILE n 1 88 HIS n 1 89 LYS n 1 90 VAL n 1 91 THR n 1 92 VAL n 1 93 LEU n 1 94 ALA n 1 95 SER n 1 96 ASP n 1 97 GLY n 1 98 SER n 1 99 SER n 1 100 THR n 1 101 PRO n 1 102 ALA n 1 103 ARG n 1 104 ALA n 1 105 THR n 1 106 VAL n 1 107 THR n 1 108 ILE n 1 109 ASN n 1 110 VAL n 1 111 THR n 1 112 ASP n 1 113 VAL n 1 114 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PCDH9 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060417-18 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCDH9_HUMAN _struct_ref.pdbx_db_accession Q9HC56 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI HKVTVLASDGSSTPARATVTINVTDVN ; _struct_ref.pdbx_align_begin 246 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EE0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HC56 _struct_ref_seq.db_align_beg 246 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 352 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EE0 GLY A 1 ? UNP Q9HC56 ? ? 'expression tag' 1 1 1 2EE0 SER A 2 ? UNP Q9HC56 ? ? 'expression tag' 2 2 1 2EE0 SER A 3 ? UNP Q9HC56 ? ? 'expression tag' 3 3 1 2EE0 GLY A 4 ? UNP Q9HC56 ? ? 'expression tag' 4 4 1 2EE0 SER A 5 ? UNP Q9HC56 ? ? 'expression tag' 5 5 1 2EE0 SER A 6 ? UNP Q9HC56 ? ? 'expression tag' 6 6 1 2EE0 GLY A 7 ? UNP Q9HC56 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM CA domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EE0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EE0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EE0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' MRView 2.0.17 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EE0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EE0 _struct.title 'Solution structures of the CA domain of human protocadherin 9' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EE0 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CA domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 18 ? PRO A 24 ? GLN A 18 PRO A 24 A 2 ALA A 102 ? THR A 111 ? ALA A 102 THR A 111 A 3 ILE A 87 ? SER A 95 ? ILE A 87 SER A 95 A 4 ARG A 50 ? PHE A 53 ? ARG A 50 PHE A 53 B 1 SER A 32 ? GLN A 35 ? SER A 32 GLN A 35 B 2 LEU A 73 ? VAL A 76 ? LEU A 73 VAL A 76 B 3 PHE A 65 ? LEU A 67 ? PHE A 65 LEU A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 21 ? N VAL A 21 O ASN A 109 ? O ASN A 109 A 2 3 O ILE A 108 ? O ILE A 108 N HIS A 88 ? N HIS A 88 A 3 4 O LEU A 93 ? O LEU A 93 N ILE A 52 ? N ILE A 52 B 1 2 N ILE A 34 ? N ILE A 34 O ILE A 74 ? O ILE A 74 B 2 3 O THR A 75 ? O THR A 75 N ALA A 66 ? N ALA A 66 # _database_PDB_matrix.entry_id 2EE0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EE0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASN 114 114 114 ASN ASN A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -99.45 -61.97 2 1 ALA A 27 ? ? -34.41 143.29 3 1 ALA A 41 ? ? -34.85 116.93 4 1 ASP A 112 ? ? -54.65 170.27 5 2 SER A 2 ? ? -101.32 -61.36 6 2 ASN A 8 ? ? -172.70 140.03 7 2 ALA A 41 ? ? -41.40 103.73 8 2 ASP A 42 ? ? -57.28 -73.31 9 2 LYS A 62 ? ? -37.63 -32.99 10 2 LEU A 64 ? ? -39.19 -39.84 11 2 GLU A 84 ? ? -102.69 -64.01 12 2 SER A 99 ? ? -50.88 -71.99 13 3 ASP A 9 ? ? -174.26 119.64 14 3 ASN A 10 ? ? -46.35 97.82 15 3 ARG A 11 ? ? -38.20 150.02 16 3 GLU A 16 ? ? 34.79 53.78 17 3 ASN A 46 ? ? -98.43 38.18 18 3 VAL A 76 ? ? -57.96 109.56 19 3 SER A 99 ? ? -173.67 116.78 20 3 THR A 100 ? ? -36.71 138.68 21 4 ALA A 41 ? ? -44.22 97.07 22 4 ILE A 43 ? ? -56.11 92.35 23 4 ASN A 46 ? ? -97.01 36.20 24 4 ALA A 58 ? ? -42.80 155.51 25 4 SER A 79 ? ? -40.32 150.94 26 4 GLU A 84 ? ? -101.45 -62.73 27 5 PRO A 12 ? ? -69.75 97.88 28 5 ALA A 41 ? ? -52.46 109.24 29 5 SER A 79 ? ? -46.68 156.05 30 5 GLU A 83 ? ? -39.25 -26.16 31 6 SER A 5 ? ? -64.08 81.90 32 6 ASN A 10 ? ? -93.46 55.61 33 6 LYS A 15 ? ? -38.84 133.12 34 6 ALA A 41 ? ? -34.45 -32.61 35 6 ASP A 42 ? ? -76.29 47.79 36 6 ILE A 43 ? ? -58.26 109.80 37 6 ASN A 46 ? ? -67.68 93.40 38 6 SER A 79 ? ? -45.93 162.96 39 6 GLU A 84 ? ? -92.35 -62.26 40 6 THR A 100 ? ? -36.01 142.60 41 7 VAL A 33 ? ? -85.09 -73.05 42 7 ASP A 42 ? ? -102.16 46.26 43 7 LYS A 62 ? ? -39.21 -30.83 44 7 SER A 79 ? ? -44.11 155.25 45 8 ASN A 10 ? ? -95.95 54.65 46 8 ALA A 27 ? ? -36.51 143.71 47 8 VAL A 33 ? ? -72.77 -72.08 48 8 SER A 79 ? ? -47.11 153.56 49 8 SER A 99 ? ? -34.48 130.93 50 8 ASP A 112 ? ? -58.24 179.67 51 9 SER A 3 ? ? -43.51 162.68 52 9 PRO A 12 ? ? -69.81 95.83 53 9 SER A 32 ? ? -58.67 106.48 54 9 ASP A 42 ? ? -84.68 33.59 55 9 SER A 79 ? ? -48.92 153.79 56 9 SER A 98 ? ? -80.27 43.98 57 9 THR A 100 ? ? -36.13 137.83 58 10 SER A 6 ? ? -49.89 169.52 59 10 ASP A 9 ? ? -92.28 39.46 60 10 PRO A 12 ? ? -69.80 -164.22 61 10 VAL A 13 ? ? -173.12 131.10 62 10 ASP A 42 ? ? -38.82 -34.79 63 10 ALA A 47 ? ? -161.88 117.31 64 10 GLU A 84 ? ? -99.35 -65.34 65 10 ASP A 96 ? ? -122.13 -55.21 66 11 VAL A 33 ? ? -91.43 -70.18 67 11 ALA A 41 ? ? -65.99 76.12 68 11 GLU A 48 ? ? -53.00 87.76 69 11 SER A 99 ? ? -51.84 -175.98 70 11 THR A 100 ? ? -34.08 136.52 71 12 SER A 3 ? ? -86.64 42.74 72 12 ASN A 10 ? ? -95.04 30.40 73 12 ASP A 40 ? ? -127.92 -53.72 74 12 ASP A 42 ? ? -68.57 70.38 75 12 GLU A 48 ? ? -50.18 87.21 76 12 GLU A 83 ? ? -39.01 -28.27 77 12 GLU A 84 ? ? -96.02 -60.02 78 12 ASP A 96 ? ? -130.67 -36.21 79 12 SER A 99 ? ? -74.39 -75.09 80 13 ASN A 10 ? ? -170.21 132.29 81 14 ALA A 27 ? ? -35.17 143.83 82 14 ALA A 41 ? ? -38.83 98.47 83 14 ASN A 46 ? ? 39.06 43.65 84 14 GLU A 83 ? ? -39.59 -29.16 85 15 SER A 3 ? ? -45.77 103.53 86 15 ILE A 49 ? ? -49.42 100.87 87 15 SER A 98 ? ? 41.93 28.92 88 16 SER A 5 ? ? -46.18 166.93 89 16 SER A 6 ? ? -170.98 133.41 90 16 PRO A 12 ? ? -69.79 86.21 91 16 ASP A 42 ? ? 38.54 37.62 92 16 GLU A 48 ? ? -58.43 84.75 93 17 SER A 2 ? ? 71.43 41.86 94 17 SER A 6 ? ? -54.83 96.38 95 17 ASN A 8 ? ? 35.04 40.54 96 17 ASP A 9 ? ? -108.57 43.82 97 17 ASN A 26 ? ? -97.39 46.05 98 17 ASP A 42 ? ? -81.35 47.35 99 17 ASN A 46 ? ? -70.63 -75.07 100 17 GLU A 48 ? ? -53.25 86.30 101 17 SER A 99 ? ? -61.23 -174.99 102 17 THR A 100 ? ? -34.03 128.85 103 18 VAL A 33 ? ? -79.99 -72.60 104 18 ASP A 42 ? ? -78.63 47.90 105 18 SER A 79 ? ? -37.82 148.82 106 18 ASP A 96 ? ? -134.73 -35.64 107 18 SER A 99 ? ? -70.84 -71.62 108 19 SER A 3 ? ? -173.94 127.05 109 19 PRO A 12 ? ? -69.77 95.49 110 19 ALA A 27 ? ? -37.13 139.12 111 19 ILE A 43 ? ? -54.37 107.54 112 19 ASN A 46 ? ? -39.81 158.06 113 19 THR A 61 ? ? -39.31 -31.87 114 19 SER A 79 ? ? -39.05 149.54 115 19 GLU A 84 ? ? -78.62 -70.52 116 19 SER A 99 ? ? -53.25 -176.13 117 19 THR A 100 ? ? -34.75 127.89 118 19 PRO A 101 ? ? -69.75 -175.01 119 20 SER A 2 ? ? -131.75 -48.38 120 20 SER A 3 ? ? -66.54 97.03 121 20 ALA A 41 ? ? -44.91 103.07 #