data_2EE1 # _entry.id 2EE1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EE1 pdb_00002ee1 10.2210/pdb2ee1/pdb RCSB RCSB026548 ? ? WWPDB D_1000026548 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EE1 _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hst001000963.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structures of the Chromo domain of human chromodomain helicase-DNA-binding protein 4' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Chromodomain helicase-DNA-binding protein 4' _entity.formula_weight 7688.500 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'Chromo domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP- dependent helicase CHD4, CHD-4, Mi-2 autoantigen 218 kDa protein, Mi2-beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hst001000963.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 PRO n 1 10 GLU n 1 11 TRP n 1 12 MET n 1 13 MET n 1 14 ILE n 1 15 HIS n 1 16 ARG n 1 17 ILE n 1 18 LEU n 1 19 ASN n 1 20 HIS n 1 21 SER n 1 22 VAL n 1 23 ASP n 1 24 LYS n 1 25 LYS n 1 26 GLY n 1 27 HIS n 1 28 VAL n 1 29 HIS n 1 30 TYR n 1 31 LEU n 1 32 ILE n 1 33 LYS n 1 34 TRP n 1 35 ARG n 1 36 ASP n 1 37 LEU n 1 38 PRO n 1 39 TYR n 1 40 ASP n 1 41 GLN n 1 42 ALA n 1 43 SER n 1 44 TRP n 1 45 GLU n 1 46 SER n 1 47 GLU n 1 48 ASP n 1 49 VAL n 1 50 GLU n 1 51 ILE n 1 52 GLN n 1 53 ASP n 1 54 TYR n 1 55 ASP n 1 56 LEU n 1 57 PHE n 1 58 LYS n 1 59 GLN n 1 60 SER n 1 61 TYR n 1 62 TRP n 1 63 ASN n 1 64 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CHD4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060904-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 HIS 64 64 64 HIS HIS A . n # _exptl.entry_id 2EE1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EE1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EE1 _struct.title 'Solution structures of the Chromo domain of human chromodomain helicase-DNA-binding protein 4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EE1 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, Mi-2 autoantigen 218 kDa protein, Mi2-beta, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHD4_HUMAN _struct_ref.pdbx_db_accession Q14839 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH _struct_ref.pdbx_align_begin 618 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EE1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14839 _struct_ref_seq.db_align_beg 618 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 674 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EE1 GLY A 1 ? UNP Q14839 ? ? 'expression tag' 1 1 1 2EE1 SER A 2 ? UNP Q14839 ? ? 'expression tag' 2 2 1 2EE1 SER A 3 ? UNP Q14839 ? ? 'expression tag' 3 3 1 2EE1 GLY A 4 ? UNP Q14839 ? ? 'expression tag' 4 4 1 2EE1 SER A 5 ? UNP Q14839 ? ? 'expression tag' 5 5 1 2EE1 SER A 6 ? UNP Q14839 ? ? 'expression tag' 6 6 1 2EE1 GLY A 7 ? UNP Q14839 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 53 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 53 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 19 ? VAL A 22 ? ASN A 19 VAL A 22 A 2 VAL A 28 ? ILE A 32 ? VAL A 28 ILE A 32 A 3 SER A 43 ? SER A 46 ? SER A 43 SER A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 21 ? N SER A 21 O HIS A 29 ? O HIS A 29 A 2 3 N TYR A 30 ? N TYR A 30 O GLU A 45 ? O GLU A 45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 9 ? ? -69.72 -169.97 2 1 ARG A 16 ? ? -175.04 142.26 3 1 LEU A 31 ? ? -64.09 89.82 4 1 TRP A 34 ? ? -50.33 104.35 5 1 PRO A 38 ? ? -69.80 -173.02 6 1 ALA A 42 ? ? -39.16 154.46 7 2 ARG A 16 ? ? -171.15 146.09 8 2 ILE A 17 ? ? -65.23 93.91 9 2 LEU A 31 ? ? -64.48 86.47 10 2 TRP A 34 ? ? -53.50 106.39 11 2 PRO A 38 ? ? -69.74 -163.63 12 2 ALA A 42 ? ? -39.37 160.18 13 2 SER A 46 ? ? -52.51 171.79 14 2 TYR A 61 ? ? -36.46 -39.76 15 3 ARG A 16 ? ? -174.11 142.97 16 3 LEU A 31 ? ? -63.67 89.69 17 3 TRP A 34 ? ? -52.24 108.07 18 3 PRO A 38 ? ? -69.76 -170.57 19 3 ALA A 42 ? ? -38.29 156.29 20 3 SER A 46 ? ? -51.76 172.21 21 4 SER A 5 ? ? -128.51 -53.67 22 4 LEU A 31 ? ? -69.17 93.80 23 4 TRP A 34 ? ? -49.09 106.64 24 4 PRO A 38 ? ? -69.77 -165.46 25 4 ALA A 42 ? ? -36.54 150.58 26 4 SER A 46 ? ? -49.99 173.16 27 5 ARG A 16 ? ? -174.70 144.09 28 5 ASN A 19 ? ? -170.96 -178.95 29 5 LEU A 31 ? ? -65.06 95.61 30 5 TRP A 34 ? ? -47.53 104.30 31 5 PRO A 38 ? ? -69.77 -172.59 32 5 SER A 46 ? ? -48.97 175.40 33 6 SER A 5 ? ? -39.07 144.47 34 6 ARG A 16 ? ? -173.97 147.52 35 6 ILE A 17 ? ? -69.25 91.23 36 6 ASN A 19 ? ? -170.45 -177.38 37 6 ASP A 23 ? ? -51.19 176.43 38 6 LEU A 31 ? ? -64.65 90.99 39 6 ARG A 35 ? ? -38.79 -72.51 40 6 PRO A 38 ? ? -69.78 -167.34 41 6 SER A 46 ? ? -50.51 173.06 42 7 ASN A 19 ? ? -173.29 -178.59 43 7 LEU A 31 ? ? -64.36 91.26 44 7 TRP A 34 ? ? -49.52 105.72 45 7 PRO A 38 ? ? -69.76 -173.39 46 7 ALA A 42 ? ? -38.20 153.98 47 7 SER A 46 ? ? -49.18 169.37 48 8 SER A 2 ? ? -38.85 147.20 49 8 LEU A 31 ? ? -69.18 89.52 50 8 PRO A 38 ? ? -69.73 -168.75 51 8 SER A 46 ? ? -53.42 -178.79 52 8 SER A 60 ? ? -69.39 -70.29 53 9 SER A 5 ? ? -172.09 140.48 54 9 SER A 6 ? ? -106.49 42.93 55 9 ARG A 16 ? ? -172.74 147.54 56 9 ILE A 17 ? ? -67.89 97.47 57 9 LEU A 31 ? ? -63.80 87.98 58 9 TRP A 34 ? ? -49.63 104.46 59 9 PRO A 38 ? ? -69.70 -170.53 60 9 ASP A 53 ? ? 36.78 40.35 61 10 SER A 2 ? ? -66.21 97.22 62 10 SER A 5 ? ? -86.24 41.40 63 10 ARG A 16 ? ? -175.39 141.91 64 10 ILE A 17 ? ? -58.61 104.14 65 10 LEU A 31 ? ? -55.79 90.33 66 10 PRO A 38 ? ? -69.73 -179.34 67 10 SER A 46 ? ? -52.60 175.90 68 11 SER A 6 ? ? -39.04 116.71 69 11 MET A 12 ? ? -35.65 138.37 70 11 ARG A 16 ? ? -170.72 145.10 71 11 ILE A 17 ? ? -63.50 96.69 72 11 ASP A 23 ? ? -44.89 151.61 73 11 LEU A 31 ? ? -62.71 94.39 74 11 TRP A 34 ? ? -54.09 105.95 75 11 PRO A 38 ? ? -69.70 -163.99 76 11 ALA A 42 ? ? -36.10 149.83 77 11 SER A 46 ? ? -57.62 -179.11 78 12 ARG A 16 ? ? -171.82 147.36 79 12 LEU A 31 ? ? -63.60 86.47 80 12 TRP A 34 ? ? -50.87 106.41 81 12 ARG A 35 ? ? -34.71 -70.20 82 12 PRO A 38 ? ? -69.81 -167.90 83 13 LYS A 8 ? ? -45.69 151.22 84 13 ARG A 16 ? ? -172.79 148.96 85 13 ASP A 23 ? ? -49.29 176.11 86 13 LEU A 31 ? ? -65.04 94.47 87 13 TRP A 34 ? ? -51.66 104.04 88 13 PRO A 38 ? ? -69.71 -169.91 89 13 ALA A 42 ? ? -45.17 152.40 90 13 SER A 46 ? ? -53.77 -177.35 91 14 SER A 6 ? ? -81.85 42.05 92 14 ARG A 16 ? ? -174.28 142.91 93 14 LEU A 31 ? ? -66.92 91.58 94 14 TRP A 34 ? ? -45.71 106.21 95 14 PRO A 38 ? ? -69.70 -163.91 96 14 SER A 46 ? ? -57.28 177.59 97 15 SER A 3 ? ? -132.99 -45.77 98 15 SER A 6 ? ? 34.71 44.31 99 15 ARG A 16 ? ? -174.97 143.05 100 15 ILE A 17 ? ? -61.65 98.62 101 15 ASN A 19 ? ? -171.03 -179.77 102 15 LEU A 31 ? ? -63.41 85.86 103 15 TRP A 34 ? ? -53.58 106.62 104 15 PRO A 38 ? ? -69.77 -163.77 105 15 ALA A 42 ? ? -46.71 155.32 106 15 SER A 46 ? ? -51.30 176.44 107 16 SER A 5 ? ? 39.12 40.58 108 16 SER A 6 ? ? -90.04 36.98 109 16 ARG A 16 ? ? -174.94 145.55 110 16 ASP A 23 ? ? -48.69 178.11 111 16 LEU A 31 ? ? -67.51 88.67 112 16 TRP A 34 ? ? -50.62 108.18 113 16 PRO A 38 ? ? -69.82 -168.16 114 16 SER A 46 ? ? -49.07 179.33 115 16 ASP A 53 ? ? 36.81 40.32 116 17 ILE A 17 ? ? -69.14 96.24 117 17 LEU A 31 ? ? -66.52 86.69 118 17 TRP A 34 ? ? -59.09 104.64 119 17 PRO A 38 ? ? -69.74 -166.45 120 17 SER A 46 ? ? -53.92 172.22 121 18 SER A 2 ? ? -93.02 55.00 122 18 MET A 12 ? ? -36.71 138.71 123 18 ARG A 16 ? ? -175.26 146.55 124 18 ILE A 17 ? ? -67.30 92.48 125 18 LEU A 31 ? ? -63.92 88.42 126 18 TRP A 34 ? ? -55.18 107.04 127 18 PRO A 38 ? ? -69.75 -170.24 128 18 SER A 46 ? ? -45.27 169.94 129 19 SER A 6 ? ? -97.26 -63.74 130 19 ARG A 16 ? ? -173.22 148.56 131 19 ILE A 17 ? ? -69.92 98.84 132 19 LEU A 31 ? ? -67.47 90.57 133 19 TRP A 34 ? ? -46.79 105.48 134 19 PRO A 38 ? ? -69.71 -164.83 135 19 ALA A 42 ? ? -34.34 148.68 136 19 SER A 46 ? ? -44.25 169.00 137 20 MET A 12 ? ? -34.77 132.78 138 20 ARG A 16 ? ? -175.12 148.40 139 20 ILE A 17 ? ? -67.32 95.15 140 20 LEU A 31 ? ? -64.03 92.42 141 20 TRP A 34 ? ? -57.60 108.54 142 20 PRO A 38 ? ? -69.82 -165.76 143 20 SER A 46 ? ? -48.30 173.65 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EE1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EE1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM Chromo domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EE1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 2.0.17 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 TRP N CA sing N N 275 TRP N H sing N N 276 TRP N H2 sing N N 277 TRP CA C sing N N 278 TRP CA CB sing N N 279 TRP CA HA sing N N 280 TRP C O doub N N 281 TRP C OXT sing N N 282 TRP CB CG sing N N 283 TRP CB HB2 sing N N 284 TRP CB HB3 sing N N 285 TRP CG CD1 doub Y N 286 TRP CG CD2 sing Y N 287 TRP CD1 NE1 sing Y N 288 TRP CD1 HD1 sing N N 289 TRP CD2 CE2 doub Y N 290 TRP CD2 CE3 sing Y N 291 TRP NE1 CE2 sing Y N 292 TRP NE1 HE1 sing N N 293 TRP CE2 CZ2 sing Y N 294 TRP CE3 CZ3 doub Y N 295 TRP CE3 HE3 sing N N 296 TRP CZ2 CH2 doub Y N 297 TRP CZ2 HZ2 sing N N 298 TRP CZ3 CH2 sing Y N 299 TRP CZ3 HZ3 sing N N 300 TRP CH2 HH2 sing N N 301 TRP OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EE1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_