data_2EGA # _entry.id 2EGA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EGA pdb_00002ega 10.2210/pdb2ega/pdb RCSB RCSB026628 ? ? WWPDB D_1000026628 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EGA _pdbx_database_status.recvd_initial_deposition_date 2007-02-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002100407.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Kurosaki, C.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the first SH3 domain from human KIAA0418 protein' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Kurosaki, C.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3 and PX domain-containing protein 2A' _entity.formula_weight 7531.977 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'KIAA0418 protein, SH3 multiple domains protein 1, Five SH3 domain-containing protein, Adaptor protein TKS5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGLEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGLEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002100407.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 GLU n 1 10 GLN n 1 11 TYR n 1 12 VAL n 1 13 VAL n 1 14 VAL n 1 15 SER n 1 16 ASN n 1 17 TYR n 1 18 LYS n 1 19 LYS n 1 20 GLN n 1 21 GLU n 1 22 ASN n 1 23 SER n 1 24 GLU n 1 25 LEU n 1 26 SER n 1 27 LEU n 1 28 GLN n 1 29 ALA n 1 30 GLY n 1 31 GLU n 1 32 VAL n 1 33 VAL n 1 34 ASP n 1 35 VAL n 1 36 ILE n 1 37 GLU n 1 38 LYS n 1 39 ASN n 1 40 GLU n 1 41 SER n 1 42 GLY n 1 43 TRP n 1 44 TRP n 1 45 PHE n 1 46 VAL n 1 47 SER n 1 48 THR n 1 49 SER n 1 50 GLU n 1 51 GLU n 1 52 GLN n 1 53 GLY n 1 54 TRP n 1 55 VAL n 1 56 PRO n 1 57 ALA n 1 58 THR n 1 59 TYR n 1 60 LEU n 1 61 GLU n 1 62 ALA n 1 63 GLN n 1 64 ASN n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SH3MD1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050905-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _exptl.entry_id 2EGA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EGA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EGA _struct.title 'Solution structure of the first SH3 domain from human KIAA0418 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EGA _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPD2A_HUMAN _struct_ref.pdbx_db_accession Q5TCZ1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQN _struct_ref.pdbx_align_begin 168 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EGA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5TCZ1 _struct_ref_seq.db_align_beg 168 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EGA GLY A 1 ? UNP Q5TCZ1 ? ? 'expression tag' 1 1 1 2EGA SER A 2 ? UNP Q5TCZ1 ? ? 'expression tag' 2 2 1 2EGA SER A 3 ? UNP Q5TCZ1 ? ? 'expression tag' 3 3 1 2EGA GLY A 4 ? UNP Q5TCZ1 ? ? 'expression tag' 4 4 1 2EGA SER A 5 ? UNP Q5TCZ1 ? ? 'expression tag' 5 5 1 2EGA SER A 6 ? UNP Q5TCZ1 ? ? 'expression tag' 6 6 1 2EGA GLY A 7 ? UNP Q5TCZ1 ? ? 'expression tag' 7 7 1 2EGA SER A 65 ? UNP Q5TCZ1 ? ? 'expression tag' 65 8 1 2EGA GLY A 66 ? UNP Q5TCZ1 ? ? 'expression tag' 66 9 1 2EGA PRO A 67 ? UNP Q5TCZ1 ? ? 'expression tag' 67 10 1 2EGA SER A 68 ? UNP Q5TCZ1 ? ? 'expression tag' 68 11 1 2EGA SER A 69 ? UNP Q5TCZ1 ? ? 'expression tag' 69 12 1 2EGA GLY A 70 ? UNP Q5TCZ1 ? ? 'expression tag' 70 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 60 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 60 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? VAL A 12 ? TYR A 11 VAL A 12 A 2 GLU A 61 ? ALA A 62 ? GLU A 61 ALA A 62 B 1 ASP A 34 ? LYS A 38 ? ASP A 34 LYS A 38 B 2 TRP A 43 ? SER A 47 ? TRP A 43 SER A 47 B 3 GLN A 52 ? PRO A 56 ? GLN A 52 PRO A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 12 ? N VAL A 12 O GLU A 61 ? O GLU A 61 B 1 2 N ILE A 36 ? N ILE A 36 O PHE A 45 ? O PHE A 45 B 2 3 N TRP A 44 ? N TRP A 44 O VAL A 55 ? O VAL A 55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -109.49 71.76 2 1 SER A 26 ? ? -109.80 73.80 3 2 SER A 26 ? ? -108.61 66.49 4 2 ILE A 36 ? ? -91.12 -61.54 5 2 PRO A 67 ? ? -69.74 88.65 6 3 GLN A 20 ? ? -130.55 -41.24 7 3 SER A 23 ? ? -94.75 45.99 8 3 SER A 26 ? ? -107.29 72.02 9 3 ALA A 62 ? ? -54.81 109.18 10 4 SER A 5 ? ? -171.83 147.13 11 4 SER A 23 ? ? -124.93 -56.09 12 4 ALA A 62 ? ? -51.96 105.44 13 4 GLN A 63 ? ? -52.16 -72.55 14 5 SER A 5 ? ? -173.88 146.84 15 5 GLN A 20 ? ? -93.02 -68.92 16 5 GLU A 21 ? ? -129.71 -67.07 17 5 ALA A 62 ? ? -59.20 109.68 18 5 SER A 65 ? ? -122.73 -53.72 19 6 SER A 5 ? ? -101.15 -68.57 20 6 GLU A 21 ? ? -172.35 -179.75 21 6 ALA A 62 ? ? -51.82 105.17 22 7 SER A 3 ? ? -56.98 -74.09 23 7 GLN A 20 ? ? -123.44 -72.19 24 7 GLU A 21 ? ? -130.16 -70.80 25 7 SER A 23 ? ? -59.74 105.27 26 7 ALA A 62 ? ? -51.96 107.34 27 7 SER A 68 ? ? -107.66 60.94 28 8 SER A 6 ? ? -123.92 -68.93 29 8 LYS A 19 ? ? -100.69 46.35 30 8 ASN A 22 ? ? -57.20 -74.11 31 9 LEU A 27 ? ? -55.41 174.74 32 9 GLU A 50 ? ? -86.39 -71.72 33 10 GLN A 20 ? ? -121.99 -74.23 34 10 GLU A 21 ? ? -129.42 -67.05 35 10 SER A 23 ? ? -61.71 95.72 36 10 ILE A 36 ? ? -95.14 -60.06 37 10 ALA A 62 ? ? -51.95 105.08 38 10 GLN A 63 ? ? -52.96 108.95 39 11 ILE A 36 ? ? -104.42 -63.84 40 11 TYR A 59 ? ? -97.73 30.66 41 11 ALA A 62 ? ? -55.60 104.83 42 11 SER A 65 ? ? -113.78 -72.88 43 11 PRO A 67 ? ? -69.75 -172.95 44 12 GLN A 20 ? ? -132.94 -44.06 45 12 SER A 23 ? ? -104.89 55.81 46 13 SER A 2 ? ? -66.47 -178.69 47 13 SER A 6 ? ? -65.20 -70.94 48 13 ASN A 16 ? ? -67.69 90.32 49 13 LYS A 19 ? ? -59.54 -179.12 50 13 SER A 23 ? ? -58.53 99.30 51 14 GLN A 20 ? ? -133.46 -72.16 52 14 GLU A 21 ? ? -124.85 -60.38 53 14 SER A 23 ? ? -66.96 92.87 54 14 LEU A 27 ? ? -68.55 -174.84 55 15 GLU A 21 ? ? -124.31 -60.39 56 15 SER A 65 ? ? -116.26 64.44 57 16 SER A 2 ? ? -56.64 101.89 58 16 GLU A 21 ? ? -111.91 -73.14 59 16 ILE A 36 ? ? -100.47 -62.26 60 16 GLN A 63 ? ? -53.53 109.56 61 17 GLN A 20 ? ? -131.50 -74.44 62 17 GLU A 21 ? ? -95.45 35.82 63 17 SER A 68 ? ? -173.55 131.14 64 18 ILE A 36 ? ? -92.43 -66.59 65 18 GLN A 63 ? ? -52.56 107.39 66 18 PRO A 67 ? ? -69.83 -173.33 67 19 LEU A 27 ? ? -53.55 172.10 68 19 TYR A 59 ? ? -97.84 30.81 69 19 ASN A 64 ? ? -175.49 140.26 70 19 SER A 65 ? ? -56.99 178.84 71 19 PRO A 67 ? ? -69.71 80.34 72 20 SER A 23 ? ? -55.45 101.26 73 20 SER A 26 ? ? -69.37 85.73 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EGA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EGA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.13mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EGA _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3.2 JEOL 1 processing NMRPipe 20060324 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9807 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 PHE N N N N 165 PHE CA C N S 166 PHE C C N N 167 PHE O O N N 168 PHE CB C N N 169 PHE CG C Y N 170 PHE CD1 C Y N 171 PHE CD2 C Y N 172 PHE CE1 C Y N 173 PHE CE2 C Y N 174 PHE CZ C Y N 175 PHE OXT O N N 176 PHE H H N N 177 PHE H2 H N N 178 PHE HA H N N 179 PHE HB2 H N N 180 PHE HB3 H N N 181 PHE HD1 H N N 182 PHE HD2 H N N 183 PHE HE1 H N N 184 PHE HE2 H N N 185 PHE HZ H N N 186 PHE HXT H N N 187 PRO N N N N 188 PRO CA C N S 189 PRO C C N N 190 PRO O O N N 191 PRO CB C N N 192 PRO CG C N N 193 PRO CD C N N 194 PRO OXT O N N 195 PRO H H N N 196 PRO HA H N N 197 PRO HB2 H N N 198 PRO HB3 H N N 199 PRO HG2 H N N 200 PRO HG3 H N N 201 PRO HD2 H N N 202 PRO HD3 H N N 203 PRO HXT H N N 204 SER N N N N 205 SER CA C N S 206 SER C C N N 207 SER O O N N 208 SER CB C N N 209 SER OG O N N 210 SER OXT O N N 211 SER H H N N 212 SER H2 H N N 213 SER HA H N N 214 SER HB2 H N N 215 SER HB3 H N N 216 SER HG H N N 217 SER HXT H N N 218 THR N N N N 219 THR CA C N S 220 THR C C N N 221 THR O O N N 222 THR CB C N R 223 THR OG1 O N N 224 THR CG2 C N N 225 THR OXT O N N 226 THR H H N N 227 THR H2 H N N 228 THR HA H N N 229 THR HB H N N 230 THR HG1 H N N 231 THR HG21 H N N 232 THR HG22 H N N 233 THR HG23 H N N 234 THR HXT H N N 235 TRP N N N N 236 TRP CA C N S 237 TRP C C N N 238 TRP O O N N 239 TRP CB C N N 240 TRP CG C Y N 241 TRP CD1 C Y N 242 TRP CD2 C Y N 243 TRP NE1 N Y N 244 TRP CE2 C Y N 245 TRP CE3 C Y N 246 TRP CZ2 C Y N 247 TRP CZ3 C Y N 248 TRP CH2 C Y N 249 TRP OXT O N N 250 TRP H H N N 251 TRP H2 H N N 252 TRP HA H N N 253 TRP HB2 H N N 254 TRP HB3 H N N 255 TRP HD1 H N N 256 TRP HE1 H N N 257 TRP HE3 H N N 258 TRP HZ2 H N N 259 TRP HZ3 H N N 260 TRP HH2 H N N 261 TRP HXT H N N 262 TYR N N N N 263 TYR CA C N S 264 TYR C C N N 265 TYR O O N N 266 TYR CB C N N 267 TYR CG C Y N 268 TYR CD1 C Y N 269 TYR CD2 C Y N 270 TYR CE1 C Y N 271 TYR CE2 C Y N 272 TYR CZ C Y N 273 TYR OH O N N 274 TYR OXT O N N 275 TYR H H N N 276 TYR H2 H N N 277 TYR HA H N N 278 TYR HB2 H N N 279 TYR HB3 H N N 280 TYR HD1 H N N 281 TYR HD2 H N N 282 TYR HE1 H N N 283 TYR HE2 H N N 284 TYR HH H N N 285 TYR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 PHE N CA sing N N 156 PHE N H sing N N 157 PHE N H2 sing N N 158 PHE CA C sing N N 159 PHE CA CB sing N N 160 PHE CA HA sing N N 161 PHE C O doub N N 162 PHE C OXT sing N N 163 PHE CB CG sing N N 164 PHE CB HB2 sing N N 165 PHE CB HB3 sing N N 166 PHE CG CD1 doub Y N 167 PHE CG CD2 sing Y N 168 PHE CD1 CE1 sing Y N 169 PHE CD1 HD1 sing N N 170 PHE CD2 CE2 doub Y N 171 PHE CD2 HD2 sing N N 172 PHE CE1 CZ doub Y N 173 PHE CE1 HE1 sing N N 174 PHE CE2 CZ sing Y N 175 PHE CE2 HE2 sing N N 176 PHE CZ HZ sing N N 177 PHE OXT HXT sing N N 178 PRO N CA sing N N 179 PRO N CD sing N N 180 PRO N H sing N N 181 PRO CA C sing N N 182 PRO CA CB sing N N 183 PRO CA HA sing N N 184 PRO C O doub N N 185 PRO C OXT sing N N 186 PRO CB CG sing N N 187 PRO CB HB2 sing N N 188 PRO CB HB3 sing N N 189 PRO CG CD sing N N 190 PRO CG HG2 sing N N 191 PRO CG HG3 sing N N 192 PRO CD HD2 sing N N 193 PRO CD HD3 sing N N 194 PRO OXT HXT sing N N 195 SER N CA sing N N 196 SER N H sing N N 197 SER N H2 sing N N 198 SER CA C sing N N 199 SER CA CB sing N N 200 SER CA HA sing N N 201 SER C O doub N N 202 SER C OXT sing N N 203 SER CB OG sing N N 204 SER CB HB2 sing N N 205 SER CB HB3 sing N N 206 SER OG HG sing N N 207 SER OXT HXT sing N N 208 THR N CA sing N N 209 THR N H sing N N 210 THR N H2 sing N N 211 THR CA C sing N N 212 THR CA CB sing N N 213 THR CA HA sing N N 214 THR C O doub N N 215 THR C OXT sing N N 216 THR CB OG1 sing N N 217 THR CB CG2 sing N N 218 THR CB HB sing N N 219 THR OG1 HG1 sing N N 220 THR CG2 HG21 sing N N 221 THR CG2 HG22 sing N N 222 THR CG2 HG23 sing N N 223 THR OXT HXT sing N N 224 TRP N CA sing N N 225 TRP N H sing N N 226 TRP N H2 sing N N 227 TRP CA C sing N N 228 TRP CA CB sing N N 229 TRP CA HA sing N N 230 TRP C O doub N N 231 TRP C OXT sing N N 232 TRP CB CG sing N N 233 TRP CB HB2 sing N N 234 TRP CB HB3 sing N N 235 TRP CG CD1 doub Y N 236 TRP CG CD2 sing Y N 237 TRP CD1 NE1 sing Y N 238 TRP CD1 HD1 sing N N 239 TRP CD2 CE2 doub Y N 240 TRP CD2 CE3 sing Y N 241 TRP NE1 CE2 sing Y N 242 TRP NE1 HE1 sing N N 243 TRP CE2 CZ2 sing Y N 244 TRP CE3 CZ3 doub Y N 245 TRP CE3 HE3 sing N N 246 TRP CZ2 CH2 doub Y N 247 TRP CZ2 HZ2 sing N N 248 TRP CZ3 CH2 sing Y N 249 TRP CZ3 HZ3 sing N N 250 TRP CH2 HH2 sing N N 251 TRP OXT HXT sing N N 252 TYR N CA sing N N 253 TYR N H sing N N 254 TYR N H2 sing N N 255 TYR CA C sing N N 256 TYR CA CB sing N N 257 TYR CA HA sing N N 258 TYR C O doub N N 259 TYR C OXT sing N N 260 TYR CB CG sing N N 261 TYR CB HB2 sing N N 262 TYR CB HB3 sing N N 263 TYR CG CD1 doub Y N 264 TYR CG CD2 sing Y N 265 TYR CD1 CE1 sing Y N 266 TYR CD1 HD1 sing N N 267 TYR CD2 CE2 doub Y N 268 TYR CD2 HD2 sing N N 269 TYR CE1 CZ doub Y N 270 TYR CE1 HE1 sing N N 271 TYR CE2 CZ sing Y N 272 TYR CE2 HE2 sing N N 273 TYR CZ OH sing N N 274 TYR OH HH sing N N 275 TYR OXT HXT sing N N 276 VAL N CA sing N N 277 VAL N H sing N N 278 VAL N H2 sing N N 279 VAL CA C sing N N 280 VAL CA CB sing N N 281 VAL CA HA sing N N 282 VAL C O doub N N 283 VAL C OXT sing N N 284 VAL CB CG1 sing N N 285 VAL CB CG2 sing N N 286 VAL CB HB sing N N 287 VAL CG1 HG11 sing N N 288 VAL CG1 HG12 sing N N 289 VAL CG1 HG13 sing N N 290 VAL CG2 HG21 sing N N 291 VAL CG2 HG22 sing N N 292 VAL CG2 HG23 sing N N 293 VAL OXT HXT sing N N 294 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EGA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #