data_2EGM # _entry.id 2EGM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EGM pdb_00002egm 10.2210/pdb2egm/pdb RCSB RCSB026639 ? ? WWPDB D_1000026639 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002013526.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EGM _pdbx_database_status.recvd_initial_deposition_date 2007-03-01 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title ;Solution structure of the zf-B_box domain from human Tripartite motif protein 41 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif-containing protein 41' 6103.860 1 ? ? 'zf-B_box domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002013526.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 PRO n 1 10 GLY n 1 11 ARG n 1 12 GLY n 1 13 SER n 1 14 ARG n 1 15 VAL n 1 16 THR n 1 17 ASP n 1 18 GLN n 1 19 GLY n 1 20 ILE n 1 21 CYS n 1 22 PRO n 1 23 LYS n 1 24 HIS n 1 25 GLN n 1 26 GLU n 1 27 ALA n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 PHE n 1 32 CYS n 1 33 GLU n 1 34 VAL n 1 35 ASP n 1 36 GLU n 1 37 GLU n 1 38 ALA n 1 39 ILE n 1 40 CYS n 1 41 VAL n 1 42 VAL n 1 43 CYS n 1 44 ARG n 1 45 GLU n 1 46 SER n 1 47 ARG n 1 48 SER n 1 49 HIS n 1 50 LYS n 1 51 GLN n 1 52 HIS n 1 53 SER n 1 54 VAL n 1 55 VAL n 1 56 PRO n 1 57 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRIM41 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060508-23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI41_HUMAN _struct_ref.pdbx_db_accession Q8WV44 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL _struct_ref.pdbx_align_begin 214 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EGM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WV44 _struct_ref_seq.db_align_beg 214 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EGM GLY A 1 ? UNP Q8WV44 ? ? 'expression tag' 1 1 1 2EGM SER A 2 ? UNP Q8WV44 ? ? 'expression tag' 2 2 1 2EGM SER A 3 ? UNP Q8WV44 ? ? 'expression tag' 3 3 1 2EGM GLY A 4 ? UNP Q8WV44 ? ? 'expression tag' 4 4 1 2EGM SER A 5 ? UNP Q8WV44 ? ? 'expression tag' 5 5 1 2EGM SER A 6 ? UNP Q8WV44 ? ? 'expression tag' 6 6 1 2EGM GLY A 7 ? UNP Q8WV44 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.71mM U-15N,13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EGM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EGM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EGM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20060324 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9807 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # _exptl.entry_id 2EGM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EGM _struct.title 'Solution structure of the zf-B_box domain from human Tripartite motif protein 41' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EGM _struct_keywords.pdbx_keywords 'TRANSCRIPTION/METAL BINDING PROTEIN' _struct_keywords.text ;zf-B_box domain, Tripartite motif protein 41, TRIM41, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION-METAL BINDING PROTEIN COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 40 ? SER A 46 ? CYS A 40 SER A 46 1 ? 7 HELX_P HELX_P2 2 SER A 46 ? GLN A 51 ? SER A 46 GLN A 51 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 200 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc2 metalc ? ? A HIS 24 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 24 A ZN 200 1_555 ? ? ? ? ? ? ? 1.980 ? ? metalc3 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 300 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc4 metalc ? ? A ASP 35 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 35 A ZN 300 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc5 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 40 A ZN 200 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc6 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 200 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc7 metalc ? ? A HIS 49 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 49 A ZN 300 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc8 metalc ? ? A HIS 52 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 52 A ZN 300 1_555 ? ? ? ? ? ? ? 2.051 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 37 ? ILE A 39 ? GLU A 37 ILE A 39 A 2 LEU A 30 ? CYS A 32 ? LEU A 30 CYS A 32 A 3 VAL A 54 ? VAL A 55 ? VAL A 54 VAL A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 39 ? O ILE A 39 N LEU A 30 ? N LEU A 30 A 2 3 N PHE A 31 ? N PHE A 31 O VAL A 55 ? O VAL A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A ZN 300 ? 4 'BINDING SITE FOR RESIDUE ZN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 2 AC1 4 HIS A 24 ? HIS A 24 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 4 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 6 AC2 4 ASP A 35 ? ASP A 35 . ? 1_555 ? 7 AC2 4 HIS A 49 ? HIS A 49 . ? 1_555 ? 8 AC2 4 HIS A 52 ? HIS A 52 . ? 1_555 ? # _database_PDB_matrix.entry_id 2EGM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EGM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LEU 57 57 57 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 200 ZN ZN A . C 2 ZN 1 300 300 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 117.6 ? 2 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 103.6 ? 3 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 108.3 ? 4 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 104.3 ? 5 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 109.9 ? 6 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 113.2 ? 7 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 109.3 ? 8 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 105.1 ? 9 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 105.2 ? 10 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 107.1 ? 11 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 105.1 ? 12 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 124.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.value' 15 3 'Structure model' '_struct_conn.pdbx_dist_value' 16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 3 'Structure model' '_struct_ref_seq_dif.details' 24 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -80.08 46.66 2 1 PRO A 22 ? ? -69.74 7.26 3 1 ALA A 27 ? ? -39.69 115.87 4 1 ARG A 47 ? ? -39.88 -26.09 5 2 SER A 5 ? ? -67.80 86.00 6 2 THR A 16 ? ? -134.99 -33.41 7 2 PRO A 22 ? ? -69.78 6.45 8 2 ARG A 47 ? ? -38.81 -26.29 9 3 SER A 3 ? ? -129.37 -57.60 10 3 SER A 13 ? ? -170.95 119.13 11 3 THR A 16 ? ? -45.86 171.45 12 3 GLN A 18 ? ? -105.41 40.62 13 3 PRO A 22 ? ? -69.81 7.10 14 3 ALA A 27 ? ? -41.28 108.05 15 3 ARG A 47 ? ? -37.96 -28.36 16 4 ASP A 17 ? ? -176.28 126.19 17 4 GLN A 18 ? ? -57.16 81.82 18 4 PRO A 22 ? ? -69.79 7.73 19 4 ARG A 47 ? ? -36.96 -29.10 20 5 SER A 3 ? ? -160.94 118.08 21 5 SER A 13 ? ? -53.71 104.48 22 5 GLN A 18 ? ? 34.22 45.40 23 5 PRO A 22 ? ? -69.73 7.63 24 5 ALA A 27 ? ? -39.58 110.11 25 5 ARG A 47 ? ? -36.99 -30.71 26 6 VAL A 15 ? ? -172.88 120.36 27 6 PRO A 22 ? ? -69.82 6.94 28 6 ALA A 27 ? ? -42.69 109.38 29 6 LEU A 28 ? ? -64.50 99.89 30 7 GLN A 18 ? ? 32.97 34.99 31 7 PRO A 22 ? ? -69.70 7.30 32 7 LEU A 28 ? ? -65.94 99.00 33 7 ARG A 47 ? ? -36.95 -29.36 34 8 THR A 16 ? ? -37.76 154.64 35 8 GLN A 18 ? ? -101.75 68.67 36 8 PRO A 22 ? ? -69.78 6.93 37 9 PRO A 9 ? ? -69.70 -173.22 38 9 PRO A 22 ? ? -69.77 7.01 39 9 ALA A 27 ? ? -41.80 109.46 40 9 LEU A 28 ? ? -67.06 99.20 41 9 ARG A 47 ? ? -39.97 -25.33 42 10 ARG A 11 ? ? -118.44 77.29 43 10 SER A 13 ? ? -40.95 106.76 44 10 THR A 16 ? ? -132.73 -34.46 45 10 GLN A 18 ? ? 35.35 36.76 46 10 PRO A 22 ? ? -69.79 6.70 47 10 ARG A 47 ? ? -37.74 -29.85 48 11 SER A 6 ? ? 38.76 40.67 49 11 PRO A 22 ? ? -69.69 6.39 50 11 ALA A 27 ? ? -40.21 104.07 51 11 LEU A 28 ? ? -61.61 97.93 52 11 ARG A 47 ? ? -38.24 -26.67 53 12 SER A 2 ? ? 36.99 42.29 54 12 ASP A 17 ? ? 75.00 55.03 55 12 GLN A 18 ? ? -116.64 60.40 56 12 PRO A 22 ? ? -69.76 7.23 57 12 ALA A 27 ? ? -40.61 108.52 58 12 LEU A 28 ? ? -65.00 98.31 59 12 ARG A 47 ? ? -39.56 -25.55 60 13 SER A 13 ? ? 38.61 50.78 61 13 GLN A 18 ? ? 37.23 30.25 62 13 PRO A 22 ? ? -69.74 7.01 63 13 ALA A 27 ? ? -43.77 102.14 64 13 LEU A 28 ? ? -55.56 97.52 65 13 ARG A 47 ? ? -37.09 -29.64 66 14 VAL A 15 ? ? -43.87 152.03 67 14 PRO A 22 ? ? -69.78 8.52 68 14 ALA A 27 ? ? -35.04 117.92 69 14 ARG A 47 ? ? -36.51 -33.60 70 15 SER A 6 ? ? -39.72 144.19 71 15 THR A 16 ? ? -39.26 143.36 72 15 GLN A 18 ? ? 35.74 30.48 73 15 PRO A 22 ? ? -69.81 7.31 74 16 ARG A 14 ? ? -36.81 113.76 75 16 THR A 16 ? ? -175.50 -175.05 76 16 PRO A 22 ? ? -69.72 5.77 77 17 SER A 3 ? ? 39.11 41.19 78 17 SER A 13 ? ? -34.80 143.14 79 17 ARG A 14 ? ? -173.76 147.42 80 17 PRO A 22 ? ? -69.74 7.89 81 17 ALA A 27 ? ? -43.76 108.38 82 17 LEU A 28 ? ? -62.00 97.38 83 17 ARG A 47 ? ? -36.54 -29.76 84 18 THR A 16 ? ? -36.34 146.26 85 18 GLN A 18 ? ? -95.80 39.00 86 18 PRO A 22 ? ? -69.78 6.40 87 18 ALA A 27 ? ? -42.00 107.13 88 18 LEU A 28 ? ? -63.26 99.27 89 18 ARG A 47 ? ? -39.51 -25.39 90 18 PRO A 56 ? ? -69.74 99.25 91 19 PRO A 22 ? ? -69.76 6.50 92 19 ARG A 47 ? ? -37.18 -29.32 93 20 SER A 13 ? ? -39.06 115.94 94 20 THR A 16 ? ? -42.91 166.07 95 20 GLN A 18 ? ? -101.78 75.83 96 20 PRO A 22 ? ? -69.68 7.31 97 20 ALA A 27 ? ? -39.73 117.48 98 20 ARG A 47 ? ? -38.69 -26.38 99 20 SER A 53 ? ? -69.46 97.47 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #