data_2EJY # _entry.id 2EJY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EJY pdb_00002ejy 10.2210/pdb2ejy/pdb RCSB RCSB026756 ? ? WWPDB D_1000026756 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EJY _pdbx_database_status.recvd_initial_deposition_date 2007-03-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2EV8 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kusunoki, H.' 1 'Kohno, T.' 2 # _citation.id primary _citation.title 'Structural insight into the interaction between the p55 PDZ domain and glycophorin C' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 359 _citation.page_first 972 _citation.page_last 978 _citation.year 2007 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17572384 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2007.05.215 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kusunoki, H.' 1 ? primary 'Kohno, T.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '55 kDa erythrocyte membrane protein' 10950.690 1 ? T85C 'PDZ domain, Residues 69-153' ? 2 polymer man 'Glycophorin C' 1345.438 1 ? F127C 'C-terminal region, Residues 117-128' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'p55, Membrane protein, palmitoylated 1' 2 ;PAS-2', Glycoprotein beta, GLPC, Glycoconnectin, Sialoglycoprotein D, Glycophorin D, GPD, CD236 antigen ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGHHHHHHSGHMVRLIQFEKVTEEPMGICLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKA MKETKGMISLKVIPNQQ ; ;MGHHHHHHSGHMVRLIQFEKVTEEPMGICLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKA MKETKGMISLKVIPNQQ ; A ? 2 'polypeptide(L)' no no DAGDSSRKEYCI DAGDSSRKEYCI B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 GLY n 1 11 HIS n 1 12 MET n 1 13 VAL n 1 14 ARG n 1 15 LEU n 1 16 ILE n 1 17 GLN n 1 18 PHE n 1 19 GLU n 1 20 LYS n 1 21 VAL n 1 22 THR n 1 23 GLU n 1 24 GLU n 1 25 PRO n 1 26 MET n 1 27 GLY n 1 28 ILE n 1 29 CYS n 1 30 LEU n 1 31 LYS n 1 32 LEU n 1 33 ASN n 1 34 GLU n 1 35 LYS n 1 36 GLN n 1 37 SER n 1 38 CYS n 1 39 THR n 1 40 VAL n 1 41 ALA n 1 42 ARG n 1 43 ILE n 1 44 LEU n 1 45 HIS n 1 46 GLY n 1 47 GLY n 1 48 MET n 1 49 ILE n 1 50 HIS n 1 51 ARG n 1 52 GLN n 1 53 GLY n 1 54 SER n 1 55 LEU n 1 56 HIS n 1 57 VAL n 1 58 GLY n 1 59 ASP n 1 60 GLU n 1 61 ILE n 1 62 LEU n 1 63 GLU n 1 64 ILE n 1 65 ASN n 1 66 GLY n 1 67 THR n 1 68 ASN n 1 69 VAL n 1 70 THR n 1 71 ASN n 1 72 HIS n 1 73 SER n 1 74 VAL n 1 75 ASP n 1 76 GLN n 1 77 LEU n 1 78 GLN n 1 79 LYS n 1 80 ALA n 1 81 MET n 1 82 LYS n 1 83 GLU n 1 84 THR n 1 85 LYS n 1 86 GLY n 1 87 MET n 1 88 ILE n 1 89 SER n 1 90 LEU n 1 91 LYS n 1 92 VAL n 1 93 ILE n 1 94 PRO n 1 95 ASN n 1 96 GLN n 1 97 GLN n 2 1 ASP n 2 2 ALA n 2 3 GLY n 2 4 ASP n 2 5 SER n 2 6 SER n 2 7 ARG n 2 8 LYS n 2 9 GLU n 2 10 TYR n 2 11 CYS n 2 12 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'Rosetta(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pUBK19 ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 57 ? ? ? A . n A 1 2 GLY 2 58 ? ? ? A . n A 1 3 HIS 3 59 ? ? ? A . n A 1 4 HIS 4 60 ? ? ? A . n A 1 5 HIS 5 61 ? ? ? A . n A 1 6 HIS 6 62 ? ? ? A . n A 1 7 HIS 7 63 ? ? ? A . n A 1 8 HIS 8 64 ? ? ? A . n A 1 9 SER 9 65 ? ? ? A . n A 1 10 GLY 10 66 ? ? ? A . n A 1 11 HIS 11 67 ? ? ? A . n A 1 12 MET 12 68 ? ? ? A . n A 1 13 VAL 13 69 69 VAL VAL A . n A 1 14 ARG 14 70 70 ARG ARG A . n A 1 15 LEU 15 71 71 LEU LEU A . n A 1 16 ILE 16 72 72 ILE ILE A . n A 1 17 GLN 17 73 73 GLN GLN A . n A 1 18 PHE 18 74 74 PHE PHE A . n A 1 19 GLU 19 75 75 GLU GLU A . n A 1 20 LYS 20 76 76 LYS LYS A . n A 1 21 VAL 21 77 77 VAL VAL A . n A 1 22 THR 22 78 78 THR THR A . n A 1 23 GLU 23 79 79 GLU GLU A . n A 1 24 GLU 24 80 80 GLU GLU A . n A 1 25 PRO 25 81 81 PRO PRO A . n A 1 26 MET 26 82 82 MET MET A . n A 1 27 GLY 27 83 83 GLY GLY A . n A 1 28 ILE 28 84 84 ILE ILE A . n A 1 29 CYS 29 85 85 CYS CYS A . n A 1 30 LEU 30 86 86 LEU LEU A . n A 1 31 LYS 31 87 87 LYS LYS A . n A 1 32 LEU 32 88 88 LEU LEU A . n A 1 33 ASN 33 89 89 ASN ASN A . n A 1 34 GLU 34 90 90 GLU GLU A . n A 1 35 LYS 35 91 91 LYS LYS A . n A 1 36 GLN 36 92 92 GLN GLN A . n A 1 37 SER 37 93 93 SER SER A . n A 1 38 CYS 38 94 94 CYS CYS A . n A 1 39 THR 39 95 95 THR THR A . n A 1 40 VAL 40 96 96 VAL VAL A . n A 1 41 ALA 41 97 97 ALA ALA A . n A 1 42 ARG 42 98 98 ARG ARG A . n A 1 43 ILE 43 99 99 ILE ILE A . n A 1 44 LEU 44 100 100 LEU LEU A . n A 1 45 HIS 45 101 101 HIS HIS A . n A 1 46 GLY 46 102 102 GLY GLY A . n A 1 47 GLY 47 103 103 GLY GLY A . n A 1 48 MET 48 104 104 MET MET A . n A 1 49 ILE 49 105 105 ILE ILE A . n A 1 50 HIS 50 106 106 HIS HIS A . n A 1 51 ARG 51 107 107 ARG ARG A . n A 1 52 GLN 52 108 108 GLN GLN A . n A 1 53 GLY 53 109 109 GLY GLY A . n A 1 54 SER 54 110 110 SER SER A . n A 1 55 LEU 55 111 111 LEU LEU A . n A 1 56 HIS 56 112 112 HIS HIS A . n A 1 57 VAL 57 113 113 VAL VAL A . n A 1 58 GLY 58 114 114 GLY GLY A . n A 1 59 ASP 59 115 115 ASP ASP A . n A 1 60 GLU 60 116 116 GLU GLU A . n A 1 61 ILE 61 117 117 ILE ILE A . n A 1 62 LEU 62 118 118 LEU LEU A . n A 1 63 GLU 63 119 119 GLU GLU A . n A 1 64 ILE 64 120 120 ILE ILE A . n A 1 65 ASN 65 121 121 ASN ASN A . n A 1 66 GLY 66 122 122 GLY GLY A . n A 1 67 THR 67 123 123 THR THR A . n A 1 68 ASN 68 124 124 ASN ASN A . n A 1 69 VAL 69 125 125 VAL VAL A . n A 1 70 THR 70 126 126 THR THR A . n A 1 71 ASN 71 127 127 ASN ASN A . n A 1 72 HIS 72 128 128 HIS HIS A . n A 1 73 SER 73 129 129 SER SER A . n A 1 74 VAL 74 130 130 VAL VAL A . n A 1 75 ASP 75 131 131 ASP ASP A . n A 1 76 GLN 76 132 132 GLN GLN A . n A 1 77 LEU 77 133 133 LEU LEU A . n A 1 78 GLN 78 134 134 GLN GLN A . n A 1 79 LYS 79 135 135 LYS LYS A . n A 1 80 ALA 80 136 136 ALA ALA A . n A 1 81 MET 81 137 137 MET MET A . n A 1 82 LYS 82 138 138 LYS LYS A . n A 1 83 GLU 83 139 139 GLU GLU A . n A 1 84 THR 84 140 140 THR THR A . n A 1 85 LYS 85 141 141 LYS LYS A . n A 1 86 GLY 86 142 142 GLY GLY A . n A 1 87 MET 87 143 143 MET MET A . n A 1 88 ILE 88 144 144 ILE ILE A . n A 1 89 SER 89 145 145 SER SER A . n A 1 90 LEU 90 146 146 LEU LEU A . n A 1 91 LYS 91 147 147 LYS LYS A . n A 1 92 VAL 92 148 148 VAL VAL A . n A 1 93 ILE 93 149 149 ILE ILE A . n A 1 94 PRO 94 150 150 PRO PRO A . n A 1 95 ASN 95 151 151 ASN ASN A . n A 1 96 GLN 96 152 152 GLN GLN A . n A 1 97 GLN 97 153 153 GLN GLN A . n B 2 1 ASP 1 117 ? ? ? B . n B 2 2 ALA 2 118 ? ? ? B . n B 2 3 GLY 3 119 ? ? ? B . n B 2 4 ASP 4 120 ? ? ? B . n B 2 5 SER 5 121 ? ? ? B . n B 2 6 SER 6 122 ? ? ? B . n B 2 7 ARG 7 123 123 ARG ARG B . n B 2 8 LYS 8 124 124 LYS LYS B . n B 2 9 GLU 9 125 125 GLU GLU B . n B 2 10 TYR 10 126 126 TYR TYR B . n B 2 11 CYS 11 127 127 CYS CYS B . n B 2 12 ILE 12 128 128 ILE ILE B . n # _exptl.entry_id 2EJY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EJY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EJY _struct.title 'Solution structure of the p55 PDZ T85C domain complexed with the glycophorin C F127C peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EJY _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'GPC, MAGUK, p55, PDZ, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP EM55_HUMAN Q00013 1 ;VRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKV IPNQQ ; 69 ? 2 UNP GLPC_HUMAN P04921 2 DAGDSSRKEYFI 117 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2EJY A 13 ? 97 ? Q00013 69 ? 153 ? 69 153 2 2 2EJY B 1 ? 12 ? P04921 117 ? 128 ? 117 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EJY MET A 1 ? UNP Q00013 ? ? 'expression tag' 57 1 1 2EJY GLY A 2 ? UNP Q00013 ? ? 'expression tag' 58 2 1 2EJY HIS A 3 ? UNP Q00013 ? ? 'expression tag' 59 3 1 2EJY HIS A 4 ? UNP Q00013 ? ? 'expression tag' 60 4 1 2EJY HIS A 5 ? UNP Q00013 ? ? 'expression tag' 61 5 1 2EJY HIS A 6 ? UNP Q00013 ? ? 'expression tag' 62 6 1 2EJY HIS A 7 ? UNP Q00013 ? ? 'expression tag' 63 7 1 2EJY HIS A 8 ? UNP Q00013 ? ? 'expression tag' 64 8 1 2EJY SER A 9 ? UNP Q00013 ? ? 'expression tag' 65 9 1 2EJY GLY A 10 ? UNP Q00013 ? ? 'expression tag' 66 10 1 2EJY HIS A 11 ? UNP Q00013 ? ? 'expression tag' 67 11 1 2EJY MET A 12 ? UNP Q00013 ? ? 'expression tag' 68 12 1 2EJY CYS A 29 ? UNP Q00013 THR 85 'engineered mutation' 85 13 2 2EJY CYS B 11 ? UNP P04921 PHE 127 'engineered mutation' 127 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 47 ? GLY A 53 ? GLY A 103 GLY A 109 1 ? 7 HELX_P HELX_P2 2 VAL A 74 ? THR A 84 ? VAL A 130 THR A 140 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 29 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 11 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 85 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 127 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.032 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 29 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 11 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 85 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 127 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 14 ? LYS A 20 ? ARG A 70 LYS A 76 A 2 GLY A 86 ? ILE A 93 ? GLY A 142 ILE A 149 A 3 GLU A 60 ? ILE A 64 ? GLU A 116 ILE A 120 A 4 CYS A 38 ? ILE A 43 ? CYS A 94 ILE A 99 A 5 ILE A 28 ? LEU A 32 ? ILE A 84 LEU A 88 A 6 TYR B 10 ? CYS B 11 ? TYR B 126 CYS B 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 20 ? N LYS A 76 O GLY A 86 ? O GLY A 142 A 2 3 O LYS A 91 ? O LYS A 147 N GLU A 63 ? N GLU A 119 A 3 4 O ILE A 61 ? O ILE A 117 N CYS A 38 ? N CYS A 94 A 4 5 O ALA A 41 ? O ALA A 97 N CYS A 29 ? N CYS A 85 A 5 6 N LEU A 30 ? N LEU A 86 O TYR B 10 ? O TYR B 126 # _pdbx_entry_details.entry_id 2EJY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 89 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 92 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 92 ? ? 76.27 87.71 2 1 VAL A 96 ? ? -59.01 106.15 3 1 ARG A 98 ? ? -173.57 136.15 4 1 HIS A 128 ? ? -58.18 -165.20 5 1 ASN A 151 ? ? -96.54 41.09 6 1 GLN A 152 ? ? 61.10 109.65 7 2 GLN A 92 ? ? 71.93 88.81 8 2 VAL A 96 ? ? -58.84 106.01 9 2 ARG A 98 ? ? -173.55 141.25 10 2 HIS A 128 ? ? -59.47 -109.11 11 2 GLN A 152 ? ? 63.11 77.69 12 3 GLN A 92 ? ? 76.56 88.51 13 3 ARG A 98 ? ? -173.61 128.84 14 3 THR A 126 ? ? -103.60 -168.55 15 3 HIS A 128 ? ? -54.57 -176.10 16 3 GLN A 152 ? ? 61.50 105.44 17 4 GLN A 92 ? ? 44.02 87.15 18 4 VAL A 96 ? ? -58.79 106.36 19 4 ARG A 98 ? ? -173.53 134.43 20 4 VAL A 113 ? ? -42.38 108.32 21 4 HIS A 128 ? ? -57.26 -166.04 22 5 GLN A 92 ? ? 67.79 76.43 23 5 VAL A 96 ? ? -58.59 106.08 24 5 ARG A 98 ? ? -173.45 145.92 25 5 VAL A 125 ? ? 58.65 156.97 26 5 HIS A 128 ? ? -59.23 -163.06 27 6 GLN A 92 ? ? 67.67 89.20 28 6 VAL A 96 ? ? -58.54 106.20 29 6 ARG A 98 ? ? -172.38 126.92 30 6 HIS A 128 ? ? -57.36 -167.34 31 6 GLN A 152 ? ? -144.87 37.94 32 7 GLN A 92 ? ? 62.34 86.84 33 7 VAL A 96 ? ? -58.46 105.86 34 7 ARG A 98 ? ? -173.52 130.00 35 7 HIS A 128 ? ? -61.25 -112.59 36 7 GLU B 125 ? ? -174.99 139.13 37 8 GLN A 92 ? ? 68.56 89.84 38 8 VAL A 96 ? ? -58.80 105.99 39 8 ARG A 98 ? ? -171.22 131.63 40 8 HIS A 128 ? ? -56.76 -167.69 41 9 VAL A 77 ? ? -140.14 15.67 42 9 GLN A 92 ? ? 69.11 87.09 43 9 VAL A 96 ? ? -59.90 105.97 44 9 ARG A 98 ? ? -172.20 131.82 45 9 HIS A 128 ? ? -52.37 179.14 46 10 GLN A 92 ? ? 56.57 82.18 47 10 VAL A 96 ? ? -58.70 105.70 48 10 ARG A 98 ? ? -173.40 133.94 49 10 HIS A 128 ? ? -57.31 -166.82 50 11 GLN A 92 ? ? 71.11 88.57 51 11 SER A 93 ? ? -171.04 148.67 52 11 VAL A 96 ? ? -58.67 106.09 53 11 ARG A 98 ? ? -171.44 138.72 54 11 HIS A 128 ? ? -58.87 -116.90 55 11 GLN A 152 ? ? 173.35 132.96 56 12 GLN A 92 ? ? 50.17 81.59 57 12 VAL A 96 ? ? -58.68 106.02 58 12 ARG A 98 ? ? -172.16 134.02 59 12 SER A 110 ? ? -150.06 -45.58 60 12 THR A 126 ? ? -108.52 -167.06 61 12 HIS A 128 ? ? -57.68 -166.93 62 12 ASN A 151 ? ? 55.85 -164.50 63 12 GLN A 152 ? ? -111.12 -144.93 64 13 GLN A 92 ? ? 54.37 75.56 65 13 VAL A 96 ? ? -58.93 106.21 66 13 ARG A 98 ? ? -173.52 131.03 67 13 HIS A 128 ? ? -56.09 -171.61 68 14 GLN A 92 ? ? 59.48 77.04 69 14 HIS A 128 ? ? -52.24 -179.02 70 14 ASN A 151 ? ? -61.37 99.82 71 14 GLN A 152 ? ? -106.79 -146.42 72 15 GLN A 92 ? ? 51.90 85.98 73 15 VAL A 96 ? ? -58.51 105.92 74 15 ARG A 98 ? ? -173.44 131.29 75 15 HIS A 128 ? ? -59.40 -107.22 76 16 GLN A 92 ? ? 54.36 79.55 77 16 VAL A 96 ? ? -58.72 106.22 78 16 HIS A 128 ? ? -60.22 -111.98 79 16 ASN A 151 ? ? 56.48 177.23 80 17 GLN A 92 ? ? 45.57 74.11 81 17 VAL A 96 ? ? -58.78 105.83 82 17 ARG A 98 ? ? -171.59 139.04 83 17 HIS A 128 ? ? -54.96 -175.03 84 17 GLN A 152 ? ? 62.25 107.44 85 18 GLN A 92 ? ? 74.78 78.60 86 18 VAL A 96 ? ? -58.72 105.91 87 18 ARG A 98 ? ? -173.21 123.03 88 18 HIS A 128 ? ? -57.90 -166.91 89 19 GLN A 92 ? ? 63.99 86.97 90 19 VAL A 96 ? ? -58.80 106.15 91 19 ARG A 98 ? ? -172.71 131.53 92 19 HIS A 128 ? ? -55.29 -176.18 93 19 GLN A 152 ? ? 64.21 129.05 94 20 GLN A 92 ? ? 59.98 80.59 95 20 VAL A 96 ? ? -58.84 106.08 96 20 ARG A 98 ? ? -171.67 133.83 97 20 HIS A 128 ? ? -59.26 -105.70 98 20 GLN A 152 ? ? 62.05 97.28 # _pdbx_nmr_ensemble.entry_id 2EJY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EJY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.6mM p55 PDZ domain-GPC peptide complex (PDZ U-15N, peptide NA); 22.5mM sodium phosphate, 45mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1.2mM p55 PDZ domain-GPC peptide complex (PDZ U-13C, 15N, peptide NA); 22.5mM sodium phosphate, 45mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '1.2mM p55 PDZ domain-GPC peptide complex (PDZ U-13C, 15N, peptide NA); 22.5mM sodium phosphate, 45mM NaCl, 100% D2O' '100% D2O' 4 '0.6mM p55 PDZ domain-GPC peptide complex (peptide U-15N, PDZ NA); 22.5mM sodium phosphate, 45mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 5 '0.9mM p55 PDZ domain-GPC peptide complex (peptide U-13C, 15N, PDZ NA); 22.5mM sodium phosphate, 45mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '45 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 2 3 1 '2D F2_13C_filtered_NOESY' 3 4 1 '2D F1F2_13C_filtered_NOESY' 3 5 1 3D_15N-separated_NOESY 4 6 1 3D_13C-separated_NOESY 5 # _pdbx_nmr_details.entry_id 2EJY _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 2EJY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;the structures are based on a total of 1491 restraints, 1291 are NOE-derived distance constraints, 130 dihedral angle restraints, 70 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CNS 1.1 'Brunger, A.T.' 1 refinement CNS 1.1 'Brunger, A.T.' 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 57 ? A MET 1 2 1 Y 1 A GLY 58 ? A GLY 2 3 1 Y 1 A HIS 59 ? A HIS 3 4 1 Y 1 A HIS 60 ? A HIS 4 5 1 Y 1 A HIS 61 ? A HIS 5 6 1 Y 1 A HIS 62 ? A HIS 6 7 1 Y 1 A HIS 63 ? A HIS 7 8 1 Y 1 A HIS 64 ? A HIS 8 9 1 Y 1 A SER 65 ? A SER 9 10 1 Y 1 A GLY 66 ? A GLY 10 11 1 Y 1 A HIS 67 ? A HIS 11 12 1 Y 1 A MET 68 ? A MET 12 13 1 Y 1 B ASP 117 ? B ASP 1 14 1 Y 1 B ALA 118 ? B ALA 2 15 1 Y 1 B GLY 119 ? B GLY 3 16 1 Y 1 B ASP 120 ? B ASP 4 17 1 Y 1 B SER 121 ? B SER 5 18 1 Y 1 B SER 122 ? B SER 6 19 2 Y 1 A MET 57 ? A MET 1 20 2 Y 1 A GLY 58 ? A GLY 2 21 2 Y 1 A HIS 59 ? A HIS 3 22 2 Y 1 A HIS 60 ? A HIS 4 23 2 Y 1 A HIS 61 ? A HIS 5 24 2 Y 1 A HIS 62 ? A HIS 6 25 2 Y 1 A HIS 63 ? A HIS 7 26 2 Y 1 A HIS 64 ? A HIS 8 27 2 Y 1 A SER 65 ? A SER 9 28 2 Y 1 A GLY 66 ? A GLY 10 29 2 Y 1 A HIS 67 ? A HIS 11 30 2 Y 1 A MET 68 ? A MET 12 31 2 Y 1 B ASP 117 ? B ASP 1 32 2 Y 1 B ALA 118 ? B ALA 2 33 2 Y 1 B GLY 119 ? B GLY 3 34 2 Y 1 B ASP 120 ? B ASP 4 35 2 Y 1 B SER 121 ? B SER 5 36 2 Y 1 B SER 122 ? B SER 6 37 3 Y 1 A MET 57 ? A MET 1 38 3 Y 1 A GLY 58 ? A GLY 2 39 3 Y 1 A HIS 59 ? A HIS 3 40 3 Y 1 A HIS 60 ? A HIS 4 41 3 Y 1 A HIS 61 ? A HIS 5 42 3 Y 1 A HIS 62 ? A HIS 6 43 3 Y 1 A HIS 63 ? A HIS 7 44 3 Y 1 A HIS 64 ? A HIS 8 45 3 Y 1 A SER 65 ? A SER 9 46 3 Y 1 A GLY 66 ? A GLY 10 47 3 Y 1 A HIS 67 ? A HIS 11 48 3 Y 1 A MET 68 ? A MET 12 49 3 Y 1 B ASP 117 ? B ASP 1 50 3 Y 1 B ALA 118 ? B ALA 2 51 3 Y 1 B GLY 119 ? B GLY 3 52 3 Y 1 B ASP 120 ? B ASP 4 53 3 Y 1 B SER 121 ? B SER 5 54 3 Y 1 B SER 122 ? B SER 6 55 4 Y 1 A MET 57 ? A MET 1 56 4 Y 1 A GLY 58 ? A GLY 2 57 4 Y 1 A HIS 59 ? A HIS 3 58 4 Y 1 A HIS 60 ? A HIS 4 59 4 Y 1 A HIS 61 ? A HIS 5 60 4 Y 1 A HIS 62 ? A HIS 6 61 4 Y 1 A HIS 63 ? A HIS 7 62 4 Y 1 A HIS 64 ? A HIS 8 63 4 Y 1 A SER 65 ? A SER 9 64 4 Y 1 A GLY 66 ? A GLY 10 65 4 Y 1 A HIS 67 ? A HIS 11 66 4 Y 1 A MET 68 ? A MET 12 67 4 Y 1 B ASP 117 ? B ASP 1 68 4 Y 1 B ALA 118 ? B ALA 2 69 4 Y 1 B GLY 119 ? B GLY 3 70 4 Y 1 B ASP 120 ? B ASP 4 71 4 Y 1 B SER 121 ? B SER 5 72 4 Y 1 B SER 122 ? B SER 6 73 5 Y 1 A MET 57 ? A MET 1 74 5 Y 1 A GLY 58 ? A GLY 2 75 5 Y 1 A HIS 59 ? A HIS 3 76 5 Y 1 A HIS 60 ? A HIS 4 77 5 Y 1 A HIS 61 ? A HIS 5 78 5 Y 1 A HIS 62 ? A HIS 6 79 5 Y 1 A HIS 63 ? A HIS 7 80 5 Y 1 A HIS 64 ? A HIS 8 81 5 Y 1 A SER 65 ? A SER 9 82 5 Y 1 A GLY 66 ? A GLY 10 83 5 Y 1 A HIS 67 ? A HIS 11 84 5 Y 1 A MET 68 ? A MET 12 85 5 Y 1 B ASP 117 ? B ASP 1 86 5 Y 1 B ALA 118 ? B ALA 2 87 5 Y 1 B GLY 119 ? B GLY 3 88 5 Y 1 B ASP 120 ? B ASP 4 89 5 Y 1 B SER 121 ? B SER 5 90 5 Y 1 B SER 122 ? B SER 6 91 6 Y 1 A MET 57 ? A MET 1 92 6 Y 1 A GLY 58 ? A GLY 2 93 6 Y 1 A HIS 59 ? A HIS 3 94 6 Y 1 A HIS 60 ? A HIS 4 95 6 Y 1 A HIS 61 ? A HIS 5 96 6 Y 1 A HIS 62 ? A HIS 6 97 6 Y 1 A HIS 63 ? A HIS 7 98 6 Y 1 A HIS 64 ? A HIS 8 99 6 Y 1 A SER 65 ? A SER 9 100 6 Y 1 A GLY 66 ? A GLY 10 101 6 Y 1 A HIS 67 ? A HIS 11 102 6 Y 1 A MET 68 ? A MET 12 103 6 Y 1 B ASP 117 ? B ASP 1 104 6 Y 1 B ALA 118 ? B ALA 2 105 6 Y 1 B GLY 119 ? B GLY 3 106 6 Y 1 B ASP 120 ? B ASP 4 107 6 Y 1 B SER 121 ? B SER 5 108 6 Y 1 B SER 122 ? B SER 6 109 7 Y 1 A MET 57 ? A MET 1 110 7 Y 1 A GLY 58 ? A GLY 2 111 7 Y 1 A HIS 59 ? A HIS 3 112 7 Y 1 A HIS 60 ? A HIS 4 113 7 Y 1 A HIS 61 ? A HIS 5 114 7 Y 1 A HIS 62 ? A HIS 6 115 7 Y 1 A HIS 63 ? A HIS 7 116 7 Y 1 A HIS 64 ? A HIS 8 117 7 Y 1 A SER 65 ? A SER 9 118 7 Y 1 A GLY 66 ? A GLY 10 119 7 Y 1 A HIS 67 ? A HIS 11 120 7 Y 1 A MET 68 ? A MET 12 121 7 Y 1 B ASP 117 ? B ASP 1 122 7 Y 1 B ALA 118 ? B ALA 2 123 7 Y 1 B GLY 119 ? B GLY 3 124 7 Y 1 B ASP 120 ? B ASP 4 125 7 Y 1 B SER 121 ? B SER 5 126 7 Y 1 B SER 122 ? B SER 6 127 8 Y 1 A MET 57 ? A MET 1 128 8 Y 1 A GLY 58 ? A GLY 2 129 8 Y 1 A HIS 59 ? A HIS 3 130 8 Y 1 A HIS 60 ? A HIS 4 131 8 Y 1 A HIS 61 ? A HIS 5 132 8 Y 1 A HIS 62 ? A HIS 6 133 8 Y 1 A HIS 63 ? A HIS 7 134 8 Y 1 A HIS 64 ? A HIS 8 135 8 Y 1 A SER 65 ? A SER 9 136 8 Y 1 A GLY 66 ? A GLY 10 137 8 Y 1 A HIS 67 ? A HIS 11 138 8 Y 1 A MET 68 ? A MET 12 139 8 Y 1 B ASP 117 ? B ASP 1 140 8 Y 1 B ALA 118 ? B ALA 2 141 8 Y 1 B GLY 119 ? B GLY 3 142 8 Y 1 B ASP 120 ? B ASP 4 143 8 Y 1 B SER 121 ? B SER 5 144 8 Y 1 B SER 122 ? B SER 6 145 9 Y 1 A MET 57 ? A MET 1 146 9 Y 1 A GLY 58 ? A GLY 2 147 9 Y 1 A HIS 59 ? A HIS 3 148 9 Y 1 A HIS 60 ? A HIS 4 149 9 Y 1 A HIS 61 ? A HIS 5 150 9 Y 1 A HIS 62 ? A HIS 6 151 9 Y 1 A HIS 63 ? A HIS 7 152 9 Y 1 A HIS 64 ? A HIS 8 153 9 Y 1 A SER 65 ? A SER 9 154 9 Y 1 A GLY 66 ? A GLY 10 155 9 Y 1 A HIS 67 ? A HIS 11 156 9 Y 1 A MET 68 ? A MET 12 157 9 Y 1 B ASP 117 ? B ASP 1 158 9 Y 1 B ALA 118 ? B ALA 2 159 9 Y 1 B GLY 119 ? B GLY 3 160 9 Y 1 B ASP 120 ? B ASP 4 161 9 Y 1 B SER 121 ? B SER 5 162 9 Y 1 B SER 122 ? B SER 6 163 10 Y 1 A MET 57 ? A MET 1 164 10 Y 1 A GLY 58 ? A GLY 2 165 10 Y 1 A HIS 59 ? A HIS 3 166 10 Y 1 A HIS 60 ? A HIS 4 167 10 Y 1 A HIS 61 ? A HIS 5 168 10 Y 1 A HIS 62 ? A HIS 6 169 10 Y 1 A HIS 63 ? A HIS 7 170 10 Y 1 A HIS 64 ? A HIS 8 171 10 Y 1 A SER 65 ? A SER 9 172 10 Y 1 A GLY 66 ? A GLY 10 173 10 Y 1 A HIS 67 ? A HIS 11 174 10 Y 1 A MET 68 ? A MET 12 175 10 Y 1 B ASP 117 ? B ASP 1 176 10 Y 1 B ALA 118 ? B ALA 2 177 10 Y 1 B GLY 119 ? B GLY 3 178 10 Y 1 B ASP 120 ? B ASP 4 179 10 Y 1 B SER 121 ? B SER 5 180 10 Y 1 B SER 122 ? B SER 6 181 11 Y 1 A MET 57 ? A MET 1 182 11 Y 1 A GLY 58 ? A GLY 2 183 11 Y 1 A HIS 59 ? A HIS 3 184 11 Y 1 A HIS 60 ? A HIS 4 185 11 Y 1 A HIS 61 ? A HIS 5 186 11 Y 1 A HIS 62 ? A HIS 6 187 11 Y 1 A HIS 63 ? A HIS 7 188 11 Y 1 A HIS 64 ? A HIS 8 189 11 Y 1 A SER 65 ? A SER 9 190 11 Y 1 A GLY 66 ? A GLY 10 191 11 Y 1 A HIS 67 ? A HIS 11 192 11 Y 1 A MET 68 ? A MET 12 193 11 Y 1 B ASP 117 ? B ASP 1 194 11 Y 1 B ALA 118 ? B ALA 2 195 11 Y 1 B GLY 119 ? B GLY 3 196 11 Y 1 B ASP 120 ? B ASP 4 197 11 Y 1 B SER 121 ? B SER 5 198 11 Y 1 B SER 122 ? B SER 6 199 12 Y 1 A MET 57 ? A MET 1 200 12 Y 1 A GLY 58 ? A GLY 2 201 12 Y 1 A HIS 59 ? A HIS 3 202 12 Y 1 A HIS 60 ? A HIS 4 203 12 Y 1 A HIS 61 ? A HIS 5 204 12 Y 1 A HIS 62 ? A HIS 6 205 12 Y 1 A HIS 63 ? A HIS 7 206 12 Y 1 A HIS 64 ? A HIS 8 207 12 Y 1 A SER 65 ? A SER 9 208 12 Y 1 A GLY 66 ? A GLY 10 209 12 Y 1 A HIS 67 ? A HIS 11 210 12 Y 1 A MET 68 ? A MET 12 211 12 Y 1 B ASP 117 ? B ASP 1 212 12 Y 1 B ALA 118 ? B ALA 2 213 12 Y 1 B GLY 119 ? B GLY 3 214 12 Y 1 B ASP 120 ? B ASP 4 215 12 Y 1 B SER 121 ? B SER 5 216 12 Y 1 B SER 122 ? B SER 6 217 13 Y 1 A MET 57 ? A MET 1 218 13 Y 1 A GLY 58 ? A GLY 2 219 13 Y 1 A HIS 59 ? A HIS 3 220 13 Y 1 A HIS 60 ? A HIS 4 221 13 Y 1 A HIS 61 ? A HIS 5 222 13 Y 1 A HIS 62 ? A HIS 6 223 13 Y 1 A HIS 63 ? A HIS 7 224 13 Y 1 A HIS 64 ? A HIS 8 225 13 Y 1 A SER 65 ? A SER 9 226 13 Y 1 A GLY 66 ? A GLY 10 227 13 Y 1 A HIS 67 ? A HIS 11 228 13 Y 1 A MET 68 ? A MET 12 229 13 Y 1 B ASP 117 ? B ASP 1 230 13 Y 1 B ALA 118 ? B ALA 2 231 13 Y 1 B GLY 119 ? B GLY 3 232 13 Y 1 B ASP 120 ? B ASP 4 233 13 Y 1 B SER 121 ? B SER 5 234 13 Y 1 B SER 122 ? B SER 6 235 14 Y 1 A MET 57 ? A MET 1 236 14 Y 1 A GLY 58 ? A GLY 2 237 14 Y 1 A HIS 59 ? A HIS 3 238 14 Y 1 A HIS 60 ? A HIS 4 239 14 Y 1 A HIS 61 ? A HIS 5 240 14 Y 1 A HIS 62 ? A HIS 6 241 14 Y 1 A HIS 63 ? A HIS 7 242 14 Y 1 A HIS 64 ? A HIS 8 243 14 Y 1 A SER 65 ? A SER 9 244 14 Y 1 A GLY 66 ? A GLY 10 245 14 Y 1 A HIS 67 ? A HIS 11 246 14 Y 1 A MET 68 ? A MET 12 247 14 Y 1 B ASP 117 ? B ASP 1 248 14 Y 1 B ALA 118 ? B ALA 2 249 14 Y 1 B GLY 119 ? B GLY 3 250 14 Y 1 B ASP 120 ? B ASP 4 251 14 Y 1 B SER 121 ? B SER 5 252 14 Y 1 B SER 122 ? B SER 6 253 15 Y 1 A MET 57 ? A MET 1 254 15 Y 1 A GLY 58 ? A GLY 2 255 15 Y 1 A HIS 59 ? A HIS 3 256 15 Y 1 A HIS 60 ? A HIS 4 257 15 Y 1 A HIS 61 ? A HIS 5 258 15 Y 1 A HIS 62 ? A HIS 6 259 15 Y 1 A HIS 63 ? A HIS 7 260 15 Y 1 A HIS 64 ? A HIS 8 261 15 Y 1 A SER 65 ? A SER 9 262 15 Y 1 A GLY 66 ? A GLY 10 263 15 Y 1 A HIS 67 ? A HIS 11 264 15 Y 1 A MET 68 ? A MET 12 265 15 Y 1 B ASP 117 ? B ASP 1 266 15 Y 1 B ALA 118 ? B ALA 2 267 15 Y 1 B GLY 119 ? B GLY 3 268 15 Y 1 B ASP 120 ? B ASP 4 269 15 Y 1 B SER 121 ? B SER 5 270 15 Y 1 B SER 122 ? B SER 6 271 16 Y 1 A MET 57 ? A MET 1 272 16 Y 1 A GLY 58 ? A GLY 2 273 16 Y 1 A HIS 59 ? A HIS 3 274 16 Y 1 A HIS 60 ? A HIS 4 275 16 Y 1 A HIS 61 ? A HIS 5 276 16 Y 1 A HIS 62 ? A HIS 6 277 16 Y 1 A HIS 63 ? A HIS 7 278 16 Y 1 A HIS 64 ? A HIS 8 279 16 Y 1 A SER 65 ? A SER 9 280 16 Y 1 A GLY 66 ? A GLY 10 281 16 Y 1 A HIS 67 ? A HIS 11 282 16 Y 1 A MET 68 ? A MET 12 283 16 Y 1 B ASP 117 ? B ASP 1 284 16 Y 1 B ALA 118 ? B ALA 2 285 16 Y 1 B GLY 119 ? B GLY 3 286 16 Y 1 B ASP 120 ? B ASP 4 287 16 Y 1 B SER 121 ? B SER 5 288 16 Y 1 B SER 122 ? B SER 6 289 17 Y 1 A MET 57 ? A MET 1 290 17 Y 1 A GLY 58 ? A GLY 2 291 17 Y 1 A HIS 59 ? A HIS 3 292 17 Y 1 A HIS 60 ? A HIS 4 293 17 Y 1 A HIS 61 ? A HIS 5 294 17 Y 1 A HIS 62 ? A HIS 6 295 17 Y 1 A HIS 63 ? A HIS 7 296 17 Y 1 A HIS 64 ? A HIS 8 297 17 Y 1 A SER 65 ? A SER 9 298 17 Y 1 A GLY 66 ? A GLY 10 299 17 Y 1 A HIS 67 ? A HIS 11 300 17 Y 1 A MET 68 ? A MET 12 301 17 Y 1 B ASP 117 ? B ASP 1 302 17 Y 1 B ALA 118 ? B ALA 2 303 17 Y 1 B GLY 119 ? B GLY 3 304 17 Y 1 B ASP 120 ? B ASP 4 305 17 Y 1 B SER 121 ? B SER 5 306 17 Y 1 B SER 122 ? B SER 6 307 18 Y 1 A MET 57 ? A MET 1 308 18 Y 1 A GLY 58 ? A GLY 2 309 18 Y 1 A HIS 59 ? A HIS 3 310 18 Y 1 A HIS 60 ? A HIS 4 311 18 Y 1 A HIS 61 ? A HIS 5 312 18 Y 1 A HIS 62 ? A HIS 6 313 18 Y 1 A HIS 63 ? A HIS 7 314 18 Y 1 A HIS 64 ? A HIS 8 315 18 Y 1 A SER 65 ? A SER 9 316 18 Y 1 A GLY 66 ? A GLY 10 317 18 Y 1 A HIS 67 ? A HIS 11 318 18 Y 1 A MET 68 ? A MET 12 319 18 Y 1 B ASP 117 ? B ASP 1 320 18 Y 1 B ALA 118 ? B ALA 2 321 18 Y 1 B GLY 119 ? B GLY 3 322 18 Y 1 B ASP 120 ? B ASP 4 323 18 Y 1 B SER 121 ? B SER 5 324 18 Y 1 B SER 122 ? B SER 6 325 19 Y 1 A MET 57 ? A MET 1 326 19 Y 1 A GLY 58 ? A GLY 2 327 19 Y 1 A HIS 59 ? A HIS 3 328 19 Y 1 A HIS 60 ? A HIS 4 329 19 Y 1 A HIS 61 ? A HIS 5 330 19 Y 1 A HIS 62 ? A HIS 6 331 19 Y 1 A HIS 63 ? A HIS 7 332 19 Y 1 A HIS 64 ? A HIS 8 333 19 Y 1 A SER 65 ? A SER 9 334 19 Y 1 A GLY 66 ? A GLY 10 335 19 Y 1 A HIS 67 ? A HIS 11 336 19 Y 1 A MET 68 ? A MET 12 337 19 Y 1 B ASP 117 ? B ASP 1 338 19 Y 1 B ALA 118 ? B ALA 2 339 19 Y 1 B GLY 119 ? B GLY 3 340 19 Y 1 B ASP 120 ? B ASP 4 341 19 Y 1 B SER 121 ? B SER 5 342 19 Y 1 B SER 122 ? B SER 6 343 20 Y 1 A MET 57 ? A MET 1 344 20 Y 1 A GLY 58 ? A GLY 2 345 20 Y 1 A HIS 59 ? A HIS 3 346 20 Y 1 A HIS 60 ? A HIS 4 347 20 Y 1 A HIS 61 ? A HIS 5 348 20 Y 1 A HIS 62 ? A HIS 6 349 20 Y 1 A HIS 63 ? A HIS 7 350 20 Y 1 A HIS 64 ? A HIS 8 351 20 Y 1 A SER 65 ? A SER 9 352 20 Y 1 A GLY 66 ? A GLY 10 353 20 Y 1 A HIS 67 ? A HIS 11 354 20 Y 1 A MET 68 ? A MET 12 355 20 Y 1 B ASP 117 ? B ASP 1 356 20 Y 1 B ALA 118 ? B ALA 2 357 20 Y 1 B GLY 119 ? B GLY 3 358 20 Y 1 B ASP 120 ? B ASP 4 359 20 Y 1 B SER 121 ? B SER 5 360 20 Y 1 B SER 122 ? B SER 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 'AVANCE II' Bruker 700 ? # _atom_sites.entry_id 2EJY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #