data_2EK0 # _entry.id 2EK0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EK0 pdb_00002ek0 10.2210/pdb2ek0/pdb RCSB RCSB026758 ? ? WWPDB D_1000026758 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003001283.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2EK0 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-22 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rehse, P.H.' 1 'Yokoyama, S.' 2 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 3 # _citation.id primary _citation.title 'Stage V Sporolation Protein S (SPOVS) from Thermus thermophilus Zinc form' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rehse, P.H.' 1 ? primary 'Yokoyama, S.' 2 ? # _cell.length_a 69.237 _cell.length_b 72.772 _cell.length_c 68.438 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2EK0 _cell.pdbx_unique_axis ? _cell.Z_PDB 16 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.entry_id 2EK0 _symmetry.Int_Tables_number 20 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stage V sporulation protein S (SpoVS) related protein' 9695.244 2 ? K22M ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 water nat water 18.015 70 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;METLRVSSKSRPNSVAGAIAAMLRTKGEVEVQAIGPQAVNQAVKAIAIARGYIAPDNLDLVVKPAFVKLELENEERTALK FSIKAHPLET ; _entity_poly.pdbx_seq_one_letter_code_can ;METLRVSSKSRPNSVAGAIAAMLRTKGEVEVQAIGPQAVNQAVKAIAIARGYIAPDNLDLVVKPAFVKLELENEERTALK FSIKAHPLET ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ttk003001283.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 LEU n 1 5 ARG n 1 6 VAL n 1 7 SER n 1 8 SER n 1 9 LYS n 1 10 SER n 1 11 ARG n 1 12 PRO n 1 13 ASN n 1 14 SER n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 ALA n 1 19 ILE n 1 20 ALA n 1 21 ALA n 1 22 MET n 1 23 LEU n 1 24 ARG n 1 25 THR n 1 26 LYS n 1 27 GLY n 1 28 GLU n 1 29 VAL n 1 30 GLU n 1 31 VAL n 1 32 GLN n 1 33 ALA n 1 34 ILE n 1 35 GLY n 1 36 PRO n 1 37 GLN n 1 38 ALA n 1 39 VAL n 1 40 ASN n 1 41 GLN n 1 42 ALA n 1 43 VAL n 1 44 LYS n 1 45 ALA n 1 46 ILE n 1 47 ALA n 1 48 ILE n 1 49 ALA n 1 50 ARG n 1 51 GLY n 1 52 TYR n 1 53 ILE n 1 54 ALA n 1 55 PRO n 1 56 ASP n 1 57 ASN n 1 58 LEU n 1 59 ASP n 1 60 LEU n 1 61 VAL n 1 62 VAL n 1 63 LYS n 1 64 PRO n 1 65 ALA n 1 66 PHE n 1 67 VAL n 1 68 LYS n 1 69 LEU n 1 70 GLU n 1 71 LEU n 1 72 GLU n 1 73 ASN n 1 74 GLU n 1 75 GLU n 1 76 ARG n 1 77 THR n 1 78 ALA n 1 79 LEU n 1 80 LYS n 1 81 PHE n 1 82 SER n 1 83 ILE n 1 84 LYS n 1 85 ALA n 1 86 HIS n 1 87 PRO n 1 88 LEU n 1 89 GLU n 1 90 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene HB8 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SK02_THET8 _struct_ref.pdbx_db_accession Q5SK02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;METLRVSSKSRPNSVAGAIAALLRTKGEVEVQAIGPQAVNQAVKAIAIARGYIAPDNLDLVVKPAFVKLELENEERTALK FSIKAHPLET ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2EK0 A 1 ? 90 ? Q5SK02 1 ? 90 ? 1 90 2 1 2EK0 B 1 ? 90 ? Q5SK02 1 ? 90 ? 1 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EK0 MET A 22 ? UNP Q5SK02 LEU 22 'engineered mutation' 22 1 2 2EK0 MET B 22 ? UNP Q5SK02 LEU 22 'engineered mutation' 22 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 2EK0 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.3 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '100mM Na cacodylate, 0.2M Zn Acetate, 35% PEG 200 , pH 7.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2006-04-13 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 # _reflns.entry_id 2EK0 _reflns.d_resolution_high 1.860 _reflns.d_resolution_low 40.500 _reflns.number_obs 14671 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_netI_over_sigmaI 23.500 _reflns.pdbx_chi_squared 1.000 _reflns.pdbx_redundancy 6.400 _reflns.percent_possible_obs 98.800 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.number_all 14849 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 1.93 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.494 _reflns_shell.meanI_over_sigI_obs 2.49 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.000 _reflns_shell.pdbx_redundancy 3.20 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1357 _reflns_shell.percent_possible_all 92.60 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2EK0 _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 40.460 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 96.700 _refine.ls_number_reflns_obs 13512 _refine.ls_R_factor_R_work 0.229 _refine.ls_R_factor_R_free 0.255 _refine.ls_percent_reflns_R_free 4.900 _refine.ls_number_reflns_R_free 682 _refine.B_iso_mean 36.964 _refine.solvent_model_param_bsol 94.256 _refine.aniso_B[1][1] 2.239 _refine.aniso_B[2][2] -0.862 _refine.aniso_B[3][3] -1.377 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.pdbx_ls_sigma_I 0.0 _refine.ls_number_reflns_all 13973 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.229 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2EH1 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model anisotropic _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2EK0 _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs 0.13 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.19 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1348 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 1421 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 40.460 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.009718 1.500 ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.63907 2.000 ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 24.53473 2.000 ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 1.00900 2.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.97 _refine_ls_shell.number_reflns_obs 1215 _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.R_factor_R_work 0.2406 _refine_ls_shell.R_factor_R_free 0.2612 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_obs 87.67 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param ? 'X-RAY DIFFRACTION' 2 water_rep.param ? 'X-RAY DIFFRACTION' 3 ion.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2EK0 _struct.title 'Stage V Sporolation Protein S (SPOVS) from Thermus thermophilus Zinc form' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EK0 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Sporulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 11 ? GLY A 27 ? ARG A 11 GLY A 27 1 ? 17 HELX_P HELX_P2 2 GLY A 35 ? ALA A 54 ? GLY A 35 ALA A 54 1 ? 20 HELX_P HELX_P3 3 ARG B 11 ? LYS B 26 ? ARG B 11 LYS B 26 1 ? 16 HELX_P HELX_P4 4 GLY B 35 ? ALA B 54 ? GLY B 35 ALA B 54 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 30 OE1 ? ? ? 6_555 D ZN . ZN ? ? A GLU 30 B ZN 101 1_555 ? ? ? ? ? ? ? 2.233 ? ? metalc2 metalc ? ? A GLU 30 OE2 ? ? ? 6_555 D ZN . ZN ? ? A GLU 30 B ZN 101 1_555 ? ? ? ? ? ? ? 2.608 ? ? metalc3 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 72 A ZN 102 1_555 ? ? ? ? ? ? ? 2.511 ? ? metalc4 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 74 A ZN 102 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc5 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 74 A ZN 102 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc6 metalc ? ? A GLU 75 OE1 ? ? ? 8_555 E ZN . ZN ? ? A GLU 75 B ZN 103 1_555 ? ? ? ? ? ? ? 2.269 ? ? metalc7 metalc ? ? A GLU 75 OE1 ? ? ? 6_555 E ZN . ZN ? ? A GLU 75 B ZN 103 1_555 ? ? ? ? ? ? ? 2.266 ? ? metalc8 metalc ? ? A LYS 80 NZ ? ? ? 6_555 D ZN . ZN ? ? A LYS 80 B ZN 101 1_555 ? ? ? ? ? ? ? 2.176 ? ? metalc9 metalc ? ? C ZN . ZN ? ? ? 1_555 B GLU 30 OE1 ? ? A ZN 102 B GLU 30 8_455 ? ? ? ? ? ? ? 2.138 ? ? metalc10 metalc ? ? C ZN . ZN ? ? ? 1_555 B GLU 30 OE2 ? ? A ZN 102 B GLU 30 8_455 ? ? ? ? ? ? ? 2.495 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 1_555 B LYS 80 NZ ? ? A ZN 102 B LYS 80 8_455 ? ? ? ? ? ? ? 2.233 ? ? metalc12 metalc ? ? B GLU 74 OE2 ? ? ? 1_555 D ZN . ZN ? ? B GLU 74 B ZN 101 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc13 metalc ? ? B GLU 74 OE1 ? ? ? 1_555 D ZN . ZN ? ? B GLU 74 B ZN 101 1_555 ? ? ? ? ? ? ? 2.654 ? ? metalc14 metalc ? ? B GLU 75 OE1 ? ? ? 1_555 E ZN . ZN ? ? B GLU 75 B ZN 103 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc15 metalc ? ? B GLU 75 OE1 ? ? ? 3_655 E ZN . ZN ? ? B GLU 75 B ZN 103 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc16 metalc ? ? E ZN . ZN ? ? ? 1_555 G HOH . O ? ? B ZN 103 B HOH 110 1_555 ? ? ? ? ? ? ? 2.758 ? ? metalc17 metalc ? ? E ZN . ZN ? ? ? 1_555 G HOH . O ? ? B ZN 103 B HOH 110 3_655 ? ? ? ? ? ? ? 2.756 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 3 ? VAL A 6 ? THR A 3 VAL A 6 A 2 GLU A 28 ? ALA A 33 ? GLU A 28 ALA A 33 A 3 GLU A 74 ? PRO A 87 ? GLU A 74 PRO A 87 A 4 LEU A 58 ? LEU A 71 ? LEU A 58 LEU A 71 B 1 THR B 3 ? ARG B 5 ? THR B 3 ARG B 5 B 2 GLU B 28 ? ALA B 33 ? GLU B 28 ALA B 33 B 3 GLU B 74 ? HIS B 86 ? GLU B 74 HIS B 86 B 4 ASP B 59 ? LEU B 71 ? ASP B 59 LEU B 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 4 ? N LEU A 4 O GLU A 30 ? O GLU A 30 A 2 3 N VAL A 31 ? N VAL A 31 O PHE A 81 ? O PHE A 81 A 3 4 O ARG A 76 ? O ARG A 76 N LEU A 69 ? N LEU A 69 B 1 2 N LEU B 4 ? N LEU B 4 O GLN B 32 ? O GLN B 32 B 2 3 N VAL B 29 ? N VAL B 29 O ILE B 83 ? O ILE B 83 B 3 4 O ARG B 76 ? O ARG B 76 N LEU B 69 ? N LEU B 69 # _atom_sites.entry_id 2EK0 _atom_sites.fract_transf_matrix[1][1] 0.014443 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013742 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014612 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 THR 90 90 90 THR THR A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 ARG 5 5 5 ARG ARG B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 SER 7 7 7 SER SER B . n B 1 8 SER 8 8 8 SER SER B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 PRO 12 12 12 PRO PRO B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 SER 14 14 14 SER SER B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 MET 22 22 22 MET MET B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 GLN 32 32 32 GLN GLN B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 GLY 35 35 35 GLY GLY B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 GLN 37 37 37 GLN GLN B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 GLN 41 41 41 GLN GLN B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 ALA 45 45 45 ALA ALA B . n B 1 46 ILE 46 46 46 ILE ILE B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 ARG 50 50 50 ARG ARG B . n B 1 51 GLY 51 51 51 GLY GLY B . n B 1 52 TYR 52 52 52 TYR TYR B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 ASP 56 56 56 ASP ASP B . n B 1 57 ASN 57 57 57 ASN ASN B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 ASP 59 59 59 ASP ASP B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 VAL 61 61 61 VAL VAL B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 LYS 63 63 63 LYS LYS B . n B 1 64 PRO 64 64 64 PRO PRO B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 PHE 66 66 66 PHE PHE B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 GLU 72 72 72 GLU GLU B . n B 1 73 ASN 73 73 73 ASN ASN B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 THR 77 77 77 THR THR B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 PHE 81 81 81 PHE PHE B . n B 1 82 SER 82 82 82 SER SER B . n B 1 83 ILE 83 83 83 ILE ILE B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 HIS 86 86 86 HIS HIS B . n B 1 87 PRO 87 87 87 PRO PRO B . n B 1 88 LEU 88 88 88 LEU LEU B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 THR 90 90 90 THR THR B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 102 2 ZN ZN2 A . D 2 ZN 1 101 1 ZN ZN2 B . E 2 ZN 1 103 3 ZN ZN2 B . F 3 HOH 1 103 1 HOH HOH A . F 3 HOH 2 104 3 HOH HOH A . F 3 HOH 3 105 6 HOH HOH A . F 3 HOH 4 106 8 HOH HOH A . F 3 HOH 5 107 9 HOH HOH A . F 3 HOH 6 108 10 HOH HOH A . F 3 HOH 7 109 11 HOH HOH A . F 3 HOH 8 110 12 HOH HOH A . F 3 HOH 9 111 13 HOH HOH A . F 3 HOH 10 112 15 HOH HOH A . F 3 HOH 11 113 16 HOH HOH A . F 3 HOH 12 114 17 HOH HOH A . F 3 HOH 13 115 18 HOH HOH A . F 3 HOH 14 116 19 HOH HOH A . F 3 HOH 15 117 22 HOH HOH A . F 3 HOH 16 118 23 HOH HOH A . F 3 HOH 17 119 24 HOH HOH A . F 3 HOH 18 120 26 HOH HOH A . F 3 HOH 19 121 27 HOH HOH A . F 3 HOH 20 122 28 HOH HOH A . F 3 HOH 21 123 30 HOH HOH A . F 3 HOH 22 124 37 HOH HOH A . F 3 HOH 23 125 41 HOH HOH A . F 3 HOH 24 126 44 HOH HOH A . F 3 HOH 25 127 47 HOH HOH A . F 3 HOH 26 128 48 HOH HOH A . F 3 HOH 27 129 49 HOH HOH A . F 3 HOH 28 130 51 HOH HOH A . F 3 HOH 29 131 54 HOH HOH A . F 3 HOH 30 132 56 HOH HOH A . F 3 HOH 31 133 59 HOH HOH A . F 3 HOH 32 134 62 HOH HOH A . F 3 HOH 33 135 63 HOH HOH A . F 3 HOH 34 136 64 HOH HOH A . F 3 HOH 35 137 66 HOH HOH A . F 3 HOH 36 138 67 HOH HOH A . F 3 HOH 37 139 68 HOH HOH A . F 3 HOH 38 140 69 HOH HOH A . F 3 HOH 39 141 70 HOH HOH A . G 3 HOH 1 104 2 HOH HOH B . G 3 HOH 2 105 4 HOH HOH B . G 3 HOH 3 106 5 HOH HOH B . G 3 HOH 4 107 7 HOH HOH B . G 3 HOH 5 108 14 HOH HOH B . G 3 HOH 6 109 20 HOH HOH B . G 3 HOH 7 110 21 HOH HOH B . G 3 HOH 8 111 25 HOH HOH B . G 3 HOH 9 112 29 HOH HOH B . G 3 HOH 10 113 31 HOH HOH B . G 3 HOH 11 114 32 HOH HOH B . G 3 HOH 12 115 33 HOH HOH B . G 3 HOH 13 116 34 HOH HOH B . G 3 HOH 14 117 35 HOH HOH B . G 3 HOH 15 118 36 HOH HOH B . G 3 HOH 16 119 38 HOH HOH B . G 3 HOH 17 120 39 HOH HOH B . G 3 HOH 18 121 40 HOH HOH B . G 3 HOH 19 122 42 HOH HOH B . G 3 HOH 20 123 43 HOH HOH B . G 3 HOH 21 124 45 HOH HOH B . G 3 HOH 22 125 46 HOH HOH B . G 3 HOH 23 126 50 HOH HOH B . G 3 HOH 24 127 52 HOH HOH B . G 3 HOH 25 128 53 HOH HOH B . G 3 HOH 26 129 55 HOH HOH B . G 3 HOH 27 130 57 HOH HOH B . G 3 HOH 28 131 58 HOH HOH B . G 3 HOH 29 132 60 HOH HOH B . G 3 HOH 30 133 61 HOH HOH B . G 3 HOH 31 134 65 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA,PQS dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 2 1,2 B,D,E,G 2 3,4 A,C,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1960 ? 1 MORE -57 ? 1 'SSA (A^2)' 9310 ? 2 'ABSA (A^2)' 3110 ? 2 MORE -193 ? 2 'SSA (A^2)' 19520 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 69.2370000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 34.2190000000 3 'crystal symmetry operation' 6_555 -x+1/2,-y+1/2,z+1/2 -1.0000000000 0.0000000000 0.0000000000 34.6185000000 0.0000000000 -1.0000000000 0.0000000000 36.3860000000 0.0000000000 0.0000000000 1.0000000000 34.2190000000 4 'crystal symmetry operation' 8_555 x+1/2,-y+1/2,-z 1.0000000000 0.0000000000 0.0000000000 34.6185000000 0.0000000000 -1.0000000000 0.0000000000 36.3860000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B ZN 103 ? E ZN . 2 1 B HOH 104 ? G HOH . 3 1 B HOH 107 ? G HOH . 4 1 B HOH 109 ? G HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 6_555 53.2 ? 2 OE1 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 NZ ? A LYS 80 ? A LYS 80 ? 6_555 80.1 ? 3 OE2 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 NZ ? A LYS 80 ? A LYS 80 ? 6_555 133.2 ? 4 OE1 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74 ? 1_555 112.0 ? 5 OE2 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74 ? 1_555 76.2 ? 6 NZ ? A LYS 80 ? A LYS 80 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74 ? 1_555 126.3 ? 7 OE1 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74 ? 1_555 155.9 ? 8 OE2 ? A GLU 30 ? A GLU 30 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74 ? 1_555 127.4 ? 9 NZ ? A LYS 80 ? A LYS 80 ? 6_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74 ? 1_555 93.4 ? 10 OE2 ? B GLU 74 ? B GLU 74 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74 ? 1_555 53.9 ? 11 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 86.2 ? 12 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 87.2 ? 13 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 58.2 ? 14 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 30 ? B GLU 30 ? 8_455 88.6 ? 15 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 30 ? B GLU 30 ? 8_455 117.4 ? 16 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 30 ? B GLU 30 ? 8_455 174.1 ? 17 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 30 ? B GLU 30 ? 8_455 103.4 ? 18 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 30 ? B GLU 30 ? 8_455 64.9 ? 19 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 30 ? B GLU 30 ? 8_455 121.1 ? 20 OE1 ? B GLU 30 ? B GLU 30 ? 8_455 ZN ? C ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 30 ? B GLU 30 ? 8_455 56.0 ? 21 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? B LYS 80 ? B LYS 80 ? 8_455 140.6 ? 22 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? B LYS 80 ? B LYS 80 ? 8_455 124.7 ? 23 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? B LYS 80 ? B LYS 80 ? 8_455 89.8 ? 24 OE1 ? B GLU 30 ? B GLU 30 ? 8_455 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? B LYS 80 ? B LYS 80 ? 8_455 96.0 ? 25 OE2 ? B GLU 30 ? B GLU 30 ? 8_455 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? B LYS 80 ? B LYS 80 ? 8_455 111.5 ? 26 OE1 ? A GLU 75 ? A GLU 75 ? 8_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? A GLU 75 ? A GLU 75 ? 6_555 174.7 ? 27 OE1 ? A GLU 75 ? A GLU 75 ? 8_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? B GLU 75 ? B GLU 75 ? 1_555 89.6 ? 28 OE1 ? A GLU 75 ? A GLU 75 ? 6_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? B GLU 75 ? B GLU 75 ? 1_555 89.7 ? 29 OE1 ? A GLU 75 ? A GLU 75 ? 8_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? B GLU 75 ? B GLU 75 ? 3_655 89.8 ? 30 OE1 ? A GLU 75 ? A GLU 75 ? 6_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? B GLU 75 ? B GLU 75 ? 3_655 89.9 ? 31 OE1 ? B GLU 75 ? B GLU 75 ? 1_555 ZN ? E ZN . ? B ZN 103 ? 1_555 OE1 ? B GLU 75 ? B GLU 75 ? 3_655 169.0 ? 32 OE1 ? A GLU 75 ? A GLU 75 ? 8_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 1_555 107.1 ? 33 OE1 ? A GLU 75 ? A GLU 75 ? 6_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 1_555 77.7 ? 34 OE1 ? B GLU 75 ? B GLU 75 ? 1_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 1_555 70.4 ? 35 OE1 ? B GLU 75 ? B GLU 75 ? 3_655 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 1_555 120.2 ? 36 OE1 ? A GLU 75 ? A GLU 75 ? 8_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 3_655 77.6 ? 37 OE1 ? A GLU 75 ? A GLU 75 ? 6_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 3_655 107.2 ? 38 OE1 ? B GLU 75 ? B GLU 75 ? 1_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 3_655 120.0 ? 39 OE1 ? B GLU 75 ? B GLU 75 ? 3_655 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 3_655 70.5 ? 40 O ? G HOH . ? B HOH 110 ? 1_555 ZN ? E ZN . ? B ZN 103 ? 1_555 O ? G HOH . ? B HOH 110 ? 3_655 58.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-11 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' 10 4 'Structure model' '_database_2.pdbx_DOI' 11 4 'Structure model' '_database_2.pdbx_database_accession' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 31 4 'Structure model' '_pdbx_struct_conn_angle.value' 32 4 'Structure model' '_struct_conn.pdbx_dist_value' 33 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 34 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 35 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 36 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 37 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 38 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 39 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 40 4 'Structure model' '_struct_conn.ptnr1_symmetry' 41 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 42 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 43 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 44 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 45 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 46 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 47 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 48 4 'Structure model' '_struct_conn.ptnr2_symmetry' 49 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_phasing_MR.entry_id 2EK0 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor 0.448 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc 0.574 _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.000 _pdbx_phasing_MR.d_res_low_rotation 40.460 _pdbx_phasing_MR.d_res_high_translation 3.000 _pdbx_phasing_MR.d_res_low_translation 40.460 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 MOLREP . ? other 'A. Vagin' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 3 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 4 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 7 CNS 1.1 ? ? ? ? refinement ? ? ? 8 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 138 ? ? O A HOH 139 ? ? 1.99 2 1 O A HOH 135 ? ? O A HOH 137 ? ? 2.14 3 1 OE2 A GLU 70 ? ? O A HOH 115 ? ? 2.15 4 1 OE2 B GLU 75 ? ? O B HOH 110 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 89 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 134 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_654 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 73 ? ? 52.48 11.99 2 1 ASP B 56 ? ? -74.31 24.26 3 1 GLU B 72 ? ? 56.59 -121.60 4 1 LEU B 88 ? ? -32.15 164.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 26 ? CE ? A LYS 26 CE 2 1 Y 1 A LYS 26 ? NZ ? A LYS 26 NZ 3 1 Y 1 A LYS 68 ? CE ? A LYS 68 CE 4 1 Y 1 A LYS 68 ? NZ ? A LYS 68 NZ 5 1 Y 1 B LYS 26 ? CE ? B LYS 26 CE 6 1 Y 1 B LYS 26 ? NZ ? B LYS 26 NZ 7 1 Y 1 B LYS 84 ? CG ? B LYS 84 CG 8 1 Y 1 B LYS 84 ? CD ? B LYS 84 CD 9 1 Y 1 B LYS 84 ? CE ? B LYS 84 CE 10 1 Y 1 B LYS 84 ? NZ ? B LYS 84 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #