data_2ELH # _entry.id 2ELH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ELH pdb_00002elh 10.2210/pdb2elh/pdb RCSB RCSB026811 ? ? WWPDB D_1000026811 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000782.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2ELH _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Umehara, T.' 5 'Tanaka, A.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the CENP-B N-terminal DNA-binding domain of fruit fly distal antenna CG11849-PA' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Umehara, T.' 5 ? primary 'Tanaka, A.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CG11849-PA _entity.formula_weight 9533.837 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment CENP-B_N _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name LD40883p # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCAD ALGDKMD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCAD ALGDKMD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000782.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ASN n 1 10 ILE n 1 11 ARG n 1 12 MET n 1 13 GLY n 1 14 THR n 1 15 LYS n 1 16 GLY n 1 17 LYS n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 ARG n 1 22 SER n 1 23 LEU n 1 24 THR n 1 25 PRO n 1 26 ARG n 1 27 ASP n 1 28 LYS n 1 29 ILE n 1 30 HIS n 1 31 ALA n 1 32 ILE n 1 33 GLN n 1 34 ARG n 1 35 ILE n 1 36 HIS n 1 37 ASP n 1 38 GLY n 1 39 GLU n 1 40 SER n 1 41 LYS n 1 42 ALA n 1 43 SER n 1 44 VAL n 1 45 ALA n 1 46 ARG n 1 47 ASP n 1 48 ILE n 1 49 GLY n 1 50 VAL n 1 51 PRO n 1 52 GLU n 1 53 SER n 1 54 THR n 1 55 LEU n 1 56 ARG n 1 57 GLY n 1 58 TRP n 1 59 CYS n 1 60 LYS n 1 61 ASN n 1 62 GLU n 1 63 ASP n 1 64 LYS n 1 65 LEU n 1 66 ARG n 1 67 PHE n 1 68 MET n 1 69 SER n 1 70 ARG n 1 71 GLN n 1 72 SER n 1 73 ALA n 1 74 THR n 1 75 ASP n 1 76 ASN n 1 77 LEU n 1 78 CYS n 1 79 ALA n 1 80 ASP n 1 81 ALA n 1 82 LEU n 1 83 GLY n 1 84 ASP n 1 85 LYS n 1 86 MET n 1 87 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene dan _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061030-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9VBW6_DROME _struct_ref.pdbx_db_accession Q9VBW6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCADALGDKMD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ELH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9VBW6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 80 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ELH GLY A 1 ? UNP Q9VBW6 ? ? 'expression tag' 1 1 1 2ELH SER A 2 ? UNP Q9VBW6 ? ? 'expression tag' 2 2 1 2ELH SER A 3 ? UNP Q9VBW6 ? ? 'expression tag' 3 3 1 2ELH GLY A 4 ? UNP Q9VBW6 ? ? 'expression tag' 4 4 1 2ELH SER A 5 ? UNP Q9VBW6 ? ? 'expression tag' 5 5 1 2ELH SER A 6 ? UNP Q9VBW6 ? ? 'expression tag' 6 6 1 2ELH GLY A 7 ? UNP Q9VBW6 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2ELH _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2ELH _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2ELH # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2ELH _exptl.crystals_number ? # _struct.entry_id 2ELH _struct.title 'Solution structure of the CENP-B N-terminal DNA-binding domain of fruit fly distal antenna CG11849-PA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ELH _struct_keywords.text ;LD40883p, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 24 ? GLY A 38 ? THR A 24 GLY A 38 1 ? 15 HELX_P HELX_P2 2 SER A 40 ? GLY A 49 ? SER A 40 GLY A 49 1 ? 10 HELX_P HELX_P3 3 PRO A 51 ? SER A 69 ? PRO A 51 SER A 69 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2ELH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 ASP 87 87 87 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -101.74 40.20 2 1 ASN A 9 ? ? -113.02 78.26 3 1 GLU A 39 ? ? -42.24 162.37 4 1 GLU A 52 ? ? -35.71 -36.76 5 1 LEU A 82 ? ? -42.43 153.18 6 2 SER A 2 ? ? -89.59 41.88 7 2 SER A 3 ? ? 35.51 41.82 8 2 LYS A 15 ? ? -54.60 171.22 9 2 SER A 22 ? ? -35.84 134.22 10 2 GLU A 52 ? ? -34.83 -39.60 11 2 CYS A 59 ? ? -36.50 -34.66 12 2 GLN A 71 ? ? -171.46 138.98 13 2 MET A 86 ? ? -85.67 41.73 14 3 MET A 8 ? ? 34.48 39.30 15 3 MET A 12 ? ? -133.74 -52.21 16 3 LYS A 15 ? ? -171.33 144.33 17 3 GLU A 39 ? ? -38.06 152.84 18 3 LEU A 82 ? ? -78.21 45.97 19 4 SER A 6 ? ? -41.00 155.58 20 4 LYS A 15 ? ? -172.31 142.33 21 4 ALA A 73 ? ? -46.48 159.91 22 4 LEU A 77 ? ? -46.82 174.37 23 4 ASP A 80 ? ? -174.91 135.16 24 4 ALA A 81 ? ? -172.17 131.33 25 5 THR A 14 ? ? -107.08 40.59 26 5 ARG A 34 ? ? -34.46 -37.83 27 5 GLN A 71 ? ? -43.41 160.10 28 5 SER A 72 ? ? -37.25 125.73 29 5 ALA A 73 ? ? -94.26 -60.53 30 5 THR A 74 ? ? -34.20 119.63 31 5 LEU A 82 ? ? -71.05 -74.12 32 6 PRO A 19 ? ? -69.74 -179.22 33 6 LEU A 20 ? ? -55.19 108.62 34 6 SER A 22 ? ? -39.59 129.12 35 6 GLU A 39 ? ? -42.95 160.20 36 6 ALA A 73 ? ? -34.65 126.87 37 6 THR A 74 ? ? 70.19 53.64 38 6 ASP A 80 ? ? -34.69 115.50 39 7 ASN A 9 ? ? -50.79 -177.16 40 7 THR A 14 ? ? -92.54 56.82 41 7 ALA A 81 ? ? -171.42 122.89 42 8 SER A 5 ? ? 36.46 41.87 43 8 ILE A 10 ? ? -114.45 58.25 44 8 LYS A 15 ? ? -34.49 124.07 45 8 ARG A 18 ? ? -39.93 143.99 46 8 SER A 69 ? ? -38.20 -29.68 47 8 SER A 72 ? ? -51.94 93.50 48 8 ASP A 80 ? ? -37.26 93.35 49 9 SER A 3 ? ? -131.29 -62.58 50 9 ARG A 11 ? ? -104.66 78.81 51 9 PRO A 19 ? ? -69.72 -164.57 52 9 ARG A 34 ? ? -34.37 -38.89 53 9 GLU A 39 ? ? -48.48 156.19 54 9 SER A 72 ? ? -65.33 95.94 55 9 ALA A 81 ? ? -170.96 128.31 56 10 ARG A 11 ? ? -170.06 124.65 57 10 THR A 14 ? ? 34.66 38.06 58 10 LYS A 15 ? ? -52.41 179.72 59 10 LYS A 17 ? ? 35.40 50.36 60 10 ARG A 21 ? ? -83.12 37.81 61 10 ARG A 26 ? ? -38.83 -39.25 62 10 ALA A 73 ? ? 36.61 41.21 63 11 ILE A 10 ? ? -39.11 128.47 64 11 GLU A 39 ? ? -39.96 134.89 65 11 THR A 74 ? ? -59.00 101.03 66 12 ARG A 21 ? ? -69.83 84.42 67 12 SER A 22 ? ? -171.54 125.61 68 12 GLU A 52 ? ? -39.71 -37.90 69 12 GLN A 71 ? ? -65.97 77.91 70 12 SER A 72 ? ? 34.68 41.63 71 12 ALA A 79 ? ? -36.01 130.14 72 12 MET A 86 ? ? -68.59 82.02 73 13 MET A 8 ? ? -36.80 129.57 74 13 LYS A 15 ? ? -89.19 38.95 75 13 ASP A 47 ? ? -38.45 -32.89 76 13 GLU A 52 ? ? -34.57 -39.32 77 14 SER A 3 ? ? -91.11 -60.02 78 14 ASN A 9 ? ? -102.82 79.28 79 14 ARG A 11 ? ? -86.67 36.04 80 14 THR A 14 ? ? -40.79 104.33 81 14 LYS A 15 ? ? -47.78 109.83 82 15 SER A 5 ? ? -165.78 105.95 83 15 THR A 14 ? ? -89.50 49.39 84 15 HIS A 30 ? ? -37.35 -28.31 85 15 ARG A 34 ? ? -37.08 -37.04 86 15 ALA A 73 ? ? -69.76 84.13 87 15 THR A 74 ? ? -94.48 40.87 88 16 ILE A 10 ? ? 33.96 53.62 89 16 LYS A 15 ? ? -106.74 41.97 90 16 LYS A 17 ? ? -45.98 -70.50 91 16 ARG A 21 ? ? -91.91 30.36 92 16 SER A 22 ? ? 36.99 43.37 93 16 GLU A 39 ? ? -39.88 114.77 94 16 SER A 72 ? ? -65.22 90.10 95 16 LEU A 77 ? ? -89.79 42.15 96 17 MET A 8 ? ? -95.26 42.49 97 17 THR A 14 ? ? -47.57 106.99 98 17 ARG A 34 ? ? -34.66 -38.86 99 17 GLU A 52 ? ? -39.48 -28.03 100 17 GLN A 71 ? ? -63.62 84.03 101 17 CYS A 78 ? ? -174.34 126.20 102 18 LEU A 23 ? ? -48.69 167.02 103 18 THR A 74 ? ? -172.00 137.12 104 18 LYS A 85 ? ? -172.70 142.18 105 19 SER A 3 ? ? -127.93 -61.99 106 19 ASN A 9 ? ? -125.27 -58.25 107 19 ILE A 10 ? ? 35.61 48.43 108 19 LEU A 20 ? ? -46.54 157.55 109 19 SER A 22 ? ? -35.60 136.92 110 19 LEU A 23 ? ? -62.75 -176.08 111 19 ARG A 34 ? ? -37.21 -32.99 112 19 CYS A 59 ? ? -38.30 -39.19 113 19 SER A 72 ? ? -81.44 46.87 114 19 LEU A 77 ? ? -85.77 44.92 115 19 ALA A 79 ? ? -162.04 108.34 116 20 PRO A 19 ? ? -69.77 -173.55 117 20 HIS A 30 ? ? -37.39 -28.45 118 20 SER A 72 ? ? -43.13 97.89 119 20 ASP A 80 ? ? -91.59 41.88 #