data_2ELK # _entry.id 2ELK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ELK pdb_00002elk 10.2210/pdb2elk/pdb RCSB RCSB026814 ? ? WWPDB D_1000026814 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id my_001000054.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2ELK _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Umehara, T.' 5 'Tanaka, A.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the SANT domain of fission yeast SPCC24B10.08c protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Umehara, T.' 5 ? primary 'Tanaka, A.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SPCC24B10.08c protein' _entity.formula_weight 6404.866 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SANT domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGFDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIE _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGFDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier my_001000054.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 ASP n 1 10 GLU n 1 11 ASN n 1 12 TRP n 1 13 GLY n 1 14 ALA n 1 15 ASP n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 LEU n 1 21 ILE n 1 22 ASP n 1 23 ALA n 1 24 CYS n 1 25 GLU n 1 26 THR n 1 27 LEU n 1 28 GLY n 1 29 LEU n 1 30 GLY n 1 31 ASN n 1 32 TRP n 1 33 ALA n 1 34 ASP n 1 35 ILE n 1 36 ALA n 1 37 ASP n 1 38 TYR n 1 39 VAL n 1 40 GLY n 1 41 ASN n 1 42 ALA n 1 43 ARG n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 GLU n 1 48 CYS n 1 49 ARG n 1 50 ASP n 1 51 HIS n 1 52 TYR n 1 53 LEU n 1 54 LYS n 1 55 THR n 1 56 TYR n 1 57 ILE n 1 58 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fission yeast' _entity_src_gen.gene_src_genus Schizosaccharomyces _entity_src_gen.pdbx_gene_src_gene SPCC24B10.08c _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'cell-free protein synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060618-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9P7J7_SCHPO _struct_ref.pdbx_db_accession Q9P7J7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIE _struct_ref.pdbx_align_begin 62 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ELK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P7J7 _struct_ref_seq.db_align_beg 62 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ELK GLY A 1 ? UNP Q9P7J7 ? ? 'expression tag' 1 1 1 2ELK SER A 2 ? UNP Q9P7J7 ? ? 'expression tag' 2 2 1 2ELK SER A 3 ? UNP Q9P7J7 ? ? 'expression tag' 3 3 1 2ELK GLY A 4 ? UNP Q9P7J7 ? ? 'expression tag' 4 4 1 2ELK SER A 5 ? UNP Q9P7J7 ? ? 'expression tag' 5 5 1 2ELK SER A 6 ? UNP Q9P7J7 ? ? 'expression tag' 6 6 1 2ELK GLY A 7 ? UNP Q9P7J7 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE2 _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2ELK _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2ELK _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2ELK # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection TopSpin 1.3 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2ELK _exptl.crystals_number ? # _struct.entry_id 2ELK _struct.title 'Solution structure of the SANT domain of fission yeast SPCC24B10.08c protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ELK _struct_keywords.text ;hypothetical protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 13 ? LEU A 27 ? GLY A 13 LEU A 27 1 ? 15 HELX_P HELX_P2 2 ASN A 31 ? GLY A 40 ? ASN A 31 GLY A 40 1 ? 10 HELX_P HELX_P3 3 THR A 44 ? TYR A 56 ? THR A 44 TYR A 56 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2ELK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -96.49 44.65 2 1 ASP A 15 ? ? -66.56 -70.98 3 1 THR A 26 ? ? -80.75 -71.00 4 1 ARG A 49 ? ? -61.82 -73.04 5 2 GLU A 10 ? ? 33.52 37.85 6 2 ASP A 15 ? ? -63.54 -70.62 7 2 THR A 26 ? ? -77.96 -71.05 8 2 ALA A 33 ? ? -39.63 -37.18 9 2 VAL A 39 ? ? -87.35 -71.77 10 2 CYS A 48 ? ? -37.10 -34.97 11 2 ARG A 49 ? ? -66.27 -70.99 12 3 GLU A 10 ? ? -68.69 79.68 13 3 ASP A 15 ? ? -67.20 -71.09 14 3 THR A 26 ? ? -75.91 -70.88 15 3 ARG A 49 ? ? -63.22 -73.07 16 4 ASP A 9 ? ? -133.19 -40.88 17 4 TRP A 12 ? ? -63.65 -175.37 18 4 ASP A 15 ? ? -66.84 -71.03 19 4 VAL A 39 ? ? -82.08 -70.82 20 4 ARG A 49 ? ? -62.08 -73.09 21 5 SER A 2 ? ? -129.83 -52.37 22 5 SER A 5 ? ? -48.32 105.50 23 5 TRP A 12 ? ? -52.15 -174.88 24 5 ASP A 15 ? ? -66.80 -71.10 25 5 THR A 26 ? ? -79.12 -70.02 26 5 ARG A 49 ? ? -69.04 -71.58 27 6 TRP A 12 ? ? -46.16 150.04 28 6 LEU A 29 ? ? -39.48 -33.81 29 6 ARG A 49 ? ? -65.23 -73.00 30 6 TYR A 56 ? ? -61.05 -70.41 31 7 SER A 2 ? ? 36.26 42.68 32 7 GLU A 10 ? ? -82.59 47.92 33 7 ASN A 11 ? ? -162.09 111.35 34 7 ASP A 15 ? ? -61.14 -70.43 35 7 ALA A 33 ? ? -38.40 -39.79 36 7 VAL A 39 ? ? -88.63 -70.59 37 7 ARG A 49 ? ? -56.83 -72.53 38 8 SER A 6 ? ? -35.75 101.22 39 8 GLU A 16 ? ? -48.99 -19.02 40 8 VAL A 39 ? ? -83.06 -71.46 41 8 CYS A 48 ? ? -37.18 -34.62 42 8 ARG A 49 ? ? -65.27 -72.99 43 9 PHE A 8 ? ? -93.20 45.48 44 9 GLU A 10 ? ? -89.07 31.96 45 9 ASP A 15 ? ? -64.37 -70.99 46 9 ASP A 22 ? ? -37.62 -38.59 47 9 THR A 26 ? ? -77.00 -70.08 48 9 VAL A 39 ? ? -78.90 -72.30 49 9 GLU A 47 ? ? -93.14 -62.97 50 9 ARG A 49 ? ? -56.29 -73.10 51 10 ASP A 9 ? ? -78.32 46.46 52 10 ASP A 15 ? ? -66.58 -70.82 53 10 ASP A 22 ? ? -37.08 -39.79 54 10 VAL A 39 ? ? -82.91 -70.78 55 10 CYS A 48 ? ? -37.03 -34.47 56 11 TRP A 12 ? ? -68.62 -174.88 57 11 ASP A 15 ? ? -60.94 -71.13 58 11 ALA A 33 ? ? -36.85 -34.90 59 11 VAL A 39 ? ? -80.44 -72.33 60 11 GLU A 47 ? ? -92.90 -65.35 61 11 ARG A 49 ? ? -61.12 -73.17 62 12 SER A 5 ? ? -50.58 171.97 63 12 ASP A 9 ? ? 36.28 49.42 64 12 GLU A 10 ? ? -83.61 45.49 65 12 ASN A 11 ? ? -163.70 107.44 66 12 TRP A 12 ? ? -66.70 -179.28 67 12 THR A 26 ? ? -78.89 -70.71 68 12 VAL A 39 ? ? -84.32 -72.46 69 12 ARG A 49 ? ? -59.47 -73.07 70 12 HIS A 51 ? ? -36.61 -39.00 71 13 SER A 3 ? ? -170.83 146.80 72 13 SER A 5 ? ? 36.49 41.57 73 13 PHE A 8 ? ? 38.58 40.51 74 13 ASP A 9 ? ? 35.38 42.25 75 13 GLU A 10 ? ? 33.98 47.76 76 13 ASP A 15 ? ? -63.47 -71.45 77 13 ASP A 22 ? ? -39.18 -39.86 78 13 THR A 26 ? ? -76.23 -70.51 79 13 VAL A 39 ? ? -86.04 -71.31 80 13 CYS A 48 ? ? -36.21 -36.77 81 13 ARG A 49 ? ? -59.02 -71.92 82 14 ALA A 14 ? ? -35.23 -34.22 83 14 ASP A 15 ? ? -67.16 -70.54 84 14 VAL A 39 ? ? -91.24 -68.87 85 14 CYS A 48 ? ? -35.10 -38.39 86 14 ARG A 49 ? ? -60.15 -73.02 87 15 SER A 6 ? ? -59.56 109.14 88 15 GLU A 10 ? ? 33.97 52.76 89 15 ASN A 11 ? ? -85.63 45.20 90 15 THR A 26 ? ? -79.92 -70.59 91 15 VAL A 39 ? ? -81.42 -71.74 92 15 ARG A 49 ? ? -57.41 -72.68 93 16 ASP A 15 ? ? -62.55 -71.13 94 16 THR A 26 ? ? -79.51 -70.66 95 16 CYS A 48 ? ? -35.10 -36.14 96 16 ARG A 49 ? ? -62.28 -73.07 97 16 TYR A 56 ? ? -91.02 -63.65 98 17 SER A 3 ? ? -44.66 105.57 99 17 GLU A 10 ? ? 34.12 37.21 100 17 ALA A 14 ? ? -33.85 -37.34 101 17 ASP A 15 ? ? -63.10 -71.02 102 17 THR A 26 ? ? -81.77 -71.03 103 17 LEU A 29 ? ? -37.70 -31.39 104 17 CYS A 48 ? ? -38.48 -32.80 105 18 ASN A 11 ? ? -33.81 108.40 106 18 ASP A 15 ? ? -63.00 -70.57 107 18 THR A 26 ? ? -79.33 -71.03 108 18 VAL A 39 ? ? -80.74 -73.17 109 18 ARG A 49 ? ? -57.38 -73.03 110 19 GLU A 10 ? ? -105.17 40.38 111 19 ALA A 14 ? ? -35.83 -37.29 112 19 ASP A 15 ? ? -63.97 -71.29 113 19 VAL A 39 ? ? -82.71 -71.20 114 20 ALA A 14 ? ? -34.99 -38.91 115 20 ASP A 15 ? ? -60.32 -71.05 #