data_2EM4 # _entry.id 2EM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EM4 pdb_00002em4 10.2210/pdb2em4/pdb RCSB RCSB026834 ? ? WWPDB D_1000026834 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2EM4 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-28 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003011815.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Tochio, N.' 2 'Abe, H.' 3 'Saito, K.' 4 'Li, H.' 5 'Sato, M.' 6 'Koshiba, S.' 7 'Kobayashi, N.' 8 'Kigawa, T.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Abe, H.' 3 ? primary 'Saito, K.' 4 ? primary 'Li, H.' 5 ? primary 'Sato, M.' 6 ? primary 'Koshiba, S.' 7 ? primary 'Kobayashi, N.' 8 ? primary 'Kigawa, T.' 9 ? primary 'Yokoyama, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 28 homolog' 4750.254 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zfp-28, Krueppel-like zinc finger factor X6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003011815.3 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 GLY n 1 10 GLN n 1 11 ARG n 1 12 PRO n 1 13 TYR n 1 14 GLU n 1 15 CYS n 1 16 ILE n 1 17 GLU n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 ALA n 1 22 PHE n 1 23 LYS n 1 24 THR n 1 25 LYS n 1 26 SER n 1 27 SER n 1 28 LEU n 1 29 ILE n 1 30 CYS n 1 31 HIS n 1 32 ARG n 1 33 ARG n 1 34 SER n 1 35 HIS n 1 36 THR n 1 37 GLY n 1 38 GLU n 1 39 LYS n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZFP28 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061225-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EM4 _exptl.crystals_number ? # _struct.entry_id 2EM4 _struct.title 'Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EM4 _struct_keywords.text ;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZFP28_HUMAN _struct_ref.pdbx_db_accession Q8NHY6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TGQRPYECIECGKAFKTKSSLICHRRSHTGEKP _struct_ref.pdbx_align_begin 724 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EM4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NHY6 _struct_ref_seq.db_align_beg 724 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 756 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EM4 GLY A 1 ? UNP Q8NHY6 ? ? 'expression tag' 1 1 1 2EM4 SER A 2 ? UNP Q8NHY6 ? ? 'expression tag' 2 2 1 2EM4 SER A 3 ? UNP Q8NHY6 ? ? 'expression tag' 3 3 1 2EM4 GLY A 4 ? UNP Q8NHY6 ? ? 'expression tag' 4 4 1 2EM4 SER A 5 ? UNP Q8NHY6 ? ? 'expression tag' 5 5 1 2EM4 SER A 6 ? UNP Q8NHY6 ? ? 'expression tag' 6 6 1 2EM4 GLY A 7 ? UNP Q8NHY6 ? ? 'expression tag' 7 7 1 2EM4 SER A 41 ? UNP Q8NHY6 ? ? 'expression tag' 41 8 1 2EM4 GLY A 42 ? UNP Q8NHY6 ? ? 'expression tag' 42 9 1 2EM4 PRO A 43 ? UNP Q8NHY6 ? ? 'expression tag' 43 10 1 2EM4 SER A 44 ? UNP Q8NHY6 ? ? 'expression tag' 44 11 1 2EM4 SER A 45 ? UNP Q8NHY6 ? ? 'expression tag' 45 12 1 2EM4 GLY A 46 ? UNP Q8NHY6 ? ? 'expression tag' 46 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 36 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 24 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 36 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 201 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc3 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 201 1_555 ? ? ? ? ? ? ? 1.999 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 18 ? A CYS 18 ? 1_555 121.4 ? 2 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 104.9 ? 3 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 103.1 ? 4 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 122.2 ? 5 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 105.7 ? 6 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 94.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 13 ? GLU A 14 ? TYR A 13 GLU A 14 A 2 ALA A 21 ? PHE A 22 ? ALA A 21 PHE A 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 13 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 22 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 26 ? ? -36.56 -39.51 2 1 LYS A 39 ? ? -174.97 143.97 3 2 THR A 8 ? ? -93.18 33.35 4 2 HIS A 35 ? ? -48.73 -74.90 5 3 SER A 5 ? ? -84.84 42.82 6 3 SER A 34 ? ? -39.26 -32.18 7 3 GLU A 38 ? ? -79.35 45.87 8 3 LYS A 39 ? ? -171.53 147.93 9 3 PRO A 43 ? ? -69.82 1.07 10 4 ILE A 16 ? ? -88.85 46.89 11 4 GLU A 17 ? ? -130.01 -50.88 12 4 THR A 36 ? ? 38.16 41.31 13 4 PRO A 40 ? ? -69.84 94.39 14 5 ILE A 16 ? ? -83.40 42.62 15 5 GLU A 38 ? ? -60.12 95.39 16 5 PRO A 43 ? ? -69.81 2.81 17 5 SER A 44 ? ? -77.87 48.00 18 5 SER A 45 ? ? 38.94 47.33 19 6 SER A 34 ? ? -39.02 -28.42 20 7 SER A 3 ? ? -107.42 41.07 21 7 SER A 41 ? ? -42.70 158.27 22 7 PRO A 43 ? ? -69.76 98.50 23 7 SER A 45 ? ? -170.62 146.45 24 8 SER A 2 ? ? -111.49 62.14 25 8 SER A 3 ? ? -94.38 52.27 26 8 SER A 6 ? ? -174.87 149.47 27 8 GLU A 38 ? ? -172.23 133.06 28 8 PRO A 43 ? ? -69.75 -174.81 29 8 SER A 44 ? ? -92.45 -60.97 30 9 SER A 6 ? ? -132.44 -48.10 31 9 THR A 36 ? ? -88.92 39.91 32 10 GLN A 10 ? ? -104.34 -69.45 33 10 ARG A 11 ? ? -34.55 140.37 34 10 SER A 26 ? ? -34.66 -35.08 35 11 ARG A 11 ? ? -117.85 72.44 36 11 PRO A 43 ? ? -69.77 0.41 37 12 THR A 36 ? ? -87.18 39.90 38 12 PRO A 40 ? ? -69.72 -175.33 39 12 PRO A 43 ? ? -69.76 80.30 40 12 SER A 44 ? ? -170.16 136.64 41 13 SER A 5 ? ? 35.00 44.03 42 13 SER A 34 ? ? -38.61 -38.49 43 13 HIS A 35 ? ? -64.91 -73.85 44 13 PRO A 43 ? ? -69.76 2.71 45 13 SER A 45 ? ? -48.75 174.91 46 14 SER A 3 ? ? -51.55 100.25 47 14 HIS A 31 ? ? -94.08 -68.63 48 15 SER A 5 ? ? -131.55 -53.12 49 15 PRO A 40 ? ? -69.74 -177.32 50 15 SER A 41 ? ? -55.04 98.93 51 16 PRO A 12 ? ? -69.78 2.33 52 16 SER A 26 ? ? -38.31 -39.67 53 16 GLU A 38 ? ? -47.09 97.55 54 16 PRO A 40 ? ? -69.80 95.22 55 16 SER A 41 ? ? -174.07 109.01 56 17 SER A 2 ? ? -39.11 126.60 57 17 HIS A 35 ? ? -81.92 41.90 58 17 PRO A 40 ? ? -69.78 90.86 59 18 SER A 3 ? ? 39.40 40.73 60 18 THR A 8 ? ? -84.41 45.97 61 18 ARG A 11 ? ? -34.50 140.50 62 18 HIS A 35 ? ? -90.47 47.62 63 18 THR A 36 ? ? -49.80 -73.64 64 18 GLU A 38 ? ? -108.21 42.19 65 18 PRO A 40 ? ? -69.77 2.95 66 18 SER A 41 ? ? -34.49 125.98 67 18 PRO A 43 ? ? -69.68 88.04 68 19 SER A 5 ? ? -134.71 -47.07 69 19 HIS A 35 ? ? -91.22 45.96 70 19 GLU A 38 ? ? -47.68 152.09 71 19 SER A 44 ? ? 34.50 42.13 72 20 SER A 5 ? ? -94.03 42.78 73 20 SER A 26 ? ? -39.11 -26.60 74 20 PRO A 40 ? ? -69.82 4.31 75 20 SER A 41 ? ? -33.77 107.10 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2EM4 _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EM4 # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'about 1.0mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EM4 _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLN N N N N 55 GLN CA C N S 56 GLN C C N N 57 GLN O O N N 58 GLN CB C N N 59 GLN CG C N N 60 GLN CD C N N 61 GLN OE1 O N N 62 GLN NE2 N N N 63 GLN OXT O N N 64 GLN H H N N 65 GLN H2 H N N 66 GLN HA H N N 67 GLN HB2 H N N 68 GLN HB3 H N N 69 GLN HG2 H N N 70 GLN HG3 H N N 71 GLN HE21 H N N 72 GLN HE22 H N N 73 GLN HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 PHE N N N N 194 PHE CA C N S 195 PHE C C N N 196 PHE O O N N 197 PHE CB C N N 198 PHE CG C Y N 199 PHE CD1 C Y N 200 PHE CD2 C Y N 201 PHE CE1 C Y N 202 PHE CE2 C Y N 203 PHE CZ C Y N 204 PHE OXT O N N 205 PHE H H N N 206 PHE H2 H N N 207 PHE HA H N N 208 PHE HB2 H N N 209 PHE HB3 H N N 210 PHE HD1 H N N 211 PHE HD2 H N N 212 PHE HE1 H N N 213 PHE HE2 H N N 214 PHE HZ H N N 215 PHE HXT H N N 216 PRO N N N N 217 PRO CA C N S 218 PRO C C N N 219 PRO O O N N 220 PRO CB C N N 221 PRO CG C N N 222 PRO CD C N N 223 PRO OXT O N N 224 PRO H H N N 225 PRO HA H N N 226 PRO HB2 H N N 227 PRO HB3 H N N 228 PRO HG2 H N N 229 PRO HG3 H N N 230 PRO HD2 H N N 231 PRO HD3 H N N 232 PRO HXT H N N 233 SER N N N N 234 SER CA C N S 235 SER C C N N 236 SER O O N N 237 SER CB C N N 238 SER OG O N N 239 SER OXT O N N 240 SER H H N N 241 SER H2 H N N 242 SER HA H N N 243 SER HB2 H N N 244 SER HB3 H N N 245 SER HG H N N 246 SER HXT H N N 247 THR N N N N 248 THR CA C N S 249 THR C C N N 250 THR O O N N 251 THR CB C N R 252 THR OG1 O N N 253 THR CG2 C N N 254 THR OXT O N N 255 THR H H N N 256 THR H2 H N N 257 THR HA H N N 258 THR HB H N N 259 THR HG1 H N N 260 THR HG21 H N N 261 THR HG22 H N N 262 THR HG23 H N N 263 THR HXT H N N 264 TYR N N N N 265 TYR CA C N S 266 TYR C C N N 267 TYR O O N N 268 TYR CB C N N 269 TYR CG C Y N 270 TYR CD1 C Y N 271 TYR CD2 C Y N 272 TYR CE1 C Y N 273 TYR CE2 C Y N 274 TYR CZ C Y N 275 TYR OH O N N 276 TYR OXT O N N 277 TYR H H N N 278 TYR H2 H N N 279 TYR HA H N N 280 TYR HB2 H N N 281 TYR HB3 H N N 282 TYR HD1 H N N 283 TYR HD2 H N N 284 TYR HE1 H N N 285 TYR HE2 H N N 286 TYR HH H N N 287 TYR HXT H N N 288 ZN ZN ZN N N 289 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLN N CA sing N N 52 GLN N H sing N N 53 GLN N H2 sing N N 54 GLN CA C sing N N 55 GLN CA CB sing N N 56 GLN CA HA sing N N 57 GLN C O doub N N 58 GLN C OXT sing N N 59 GLN CB CG sing N N 60 GLN CB HB2 sing N N 61 GLN CB HB3 sing N N 62 GLN CG CD sing N N 63 GLN CG HG2 sing N N 64 GLN CG HG3 sing N N 65 GLN CD OE1 doub N N 66 GLN CD NE2 sing N N 67 GLN NE2 HE21 sing N N 68 GLN NE2 HE22 sing N N 69 GLN OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 PRO N CA sing N N 208 PRO N CD sing N N 209 PRO N H sing N N 210 PRO CA C sing N N 211 PRO CA CB sing N N 212 PRO CA HA sing N N 213 PRO C O doub N N 214 PRO C OXT sing N N 215 PRO CB CG sing N N 216 PRO CB HB2 sing N N 217 PRO CB HB3 sing N N 218 PRO CG CD sing N N 219 PRO CG HG2 sing N N 220 PRO CG HG3 sing N N 221 PRO CD HD2 sing N N 222 PRO CD HD3 sing N N 223 PRO OXT HXT sing N N 224 SER N CA sing N N 225 SER N H sing N N 226 SER N H2 sing N N 227 SER CA C sing N N 228 SER CA CB sing N N 229 SER CA HA sing N N 230 SER C O doub N N 231 SER C OXT sing N N 232 SER CB OG sing N N 233 SER CB HB2 sing N N 234 SER CB HB3 sing N N 235 SER OG HG sing N N 236 SER OXT HXT sing N N 237 THR N CA sing N N 238 THR N H sing N N 239 THR N H2 sing N N 240 THR CA C sing N N 241 THR CA CB sing N N 242 THR CA HA sing N N 243 THR C O doub N N 244 THR C OXT sing N N 245 THR CB OG1 sing N N 246 THR CB CG2 sing N N 247 THR CB HB sing N N 248 THR OG1 HG1 sing N N 249 THR CG2 HG21 sing N N 250 THR CG2 HG22 sing N N 251 THR CG2 HG23 sing N N 252 THR OXT HXT sing N N 253 TYR N CA sing N N 254 TYR N H sing N N 255 TYR N H2 sing N N 256 TYR CA C sing N N 257 TYR CA CB sing N N 258 TYR CA HA sing N N 259 TYR C O doub N N 260 TYR C OXT sing N N 261 TYR CB CG sing N N 262 TYR CB HB2 sing N N 263 TYR CB HB3 sing N N 264 TYR CG CD1 doub Y N 265 TYR CG CD2 sing Y N 266 TYR CD1 CE1 sing Y N 267 TYR CD1 HD1 sing N N 268 TYR CD2 CE2 doub Y N 269 TYR CD2 HD2 sing N N 270 TYR CE1 CZ doub Y N 271 TYR CE1 HE1 sing N N 272 TYR CE2 CZ sing Y N 273 TYR CE2 HE2 sing N N 274 TYR CZ OH sing N N 275 TYR OH HH sing N N 276 TYR OXT HXT sing N N 277 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EM4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #