data_2EOK # _entry.id 2EOK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EOK pdb_00002eok 10.2210/pdb2eok/pdb RCSB RCSB026914 ? ? WWPDB D_1000026914 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2EOK _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-29 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003011774.4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Tomizawa, T.' 2 'Abe, H.' 3 'Saito, K.' 4 'Li, H.' 5 'Sato, M.' 6 'Koshiba, S.' 7 'Kobayashi, N.' 8 'Kigawa, T.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Solution structure of the C2H2 type zinc finger (region 441-469) of human Zinc finger protein 268' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Abe, H.' 3 ? primary 'Saito, K.' 4 ? primary 'Li, H.' 5 ? primary 'Sato, M.' 6 ? primary 'Koshiba, S.' 7 ? primary 'Kobayashi, N.' 8 ? primary 'Kigawa, T.' 9 ? primary 'Yokoyama, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 268' 4190.609 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein HZF3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003011774.4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 LYS n 1 10 PRO n 1 11 TYR n 1 12 VAL n 1 13 CYS n 1 14 SER n 1 15 ASP n 1 16 CYS n 1 17 GLY n 1 18 LYS n 1 19 ALA n 1 20 PHE n 1 21 THR n 1 22 PHE n 1 23 LYS n 1 24 SER n 1 25 GLN n 1 26 LEU n 1 27 ILE n 1 28 VAL n 1 29 HIS n 1 30 GLN n 1 31 GLY n 1 32 ILE n 1 33 HIS n 1 34 THR n 1 35 GLY n 1 36 VAL n 1 37 SER n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 SER n 1 42 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF268 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061218-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EOK _exptl.crystals_number ? # _struct.entry_id 2EOK _struct.title 'Solution structure of the C2H2 type zinc finger (region 441-469) of human Zinc finger protein 268' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EOK _struct_keywords.text ;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN268_HUMAN _struct_ref.pdbx_db_accession Q14587 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKPYVCSDCGKAFTFKSQLIVHQGIHTGV _struct_ref.pdbx_align_begin 441 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EOK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14587 _struct_ref_seq.db_align_beg 441 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 469 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EOK GLY A 1 ? UNP Q14587 ? ? 'expression tag' 1 1 1 2EOK SER A 2 ? UNP Q14587 ? ? 'expression tag' 2 2 1 2EOK SER A 3 ? UNP Q14587 ? ? 'expression tag' 3 3 1 2EOK GLY A 4 ? UNP Q14587 ? ? 'expression tag' 4 4 1 2EOK SER A 5 ? UNP Q14587 ? ? 'expression tag' 5 5 1 2EOK SER A 6 ? UNP Q14587 ? ? 'expression tag' 6 6 1 2EOK GLY A 7 ? UNP Q14587 ? ? 'expression tag' 7 7 1 2EOK SER A 37 ? UNP Q14587 ? ? 'expression tag' 37 8 1 2EOK GLY A 38 ? UNP Q14587 ? ? 'expression tag' 38 9 1 2EOK PRO A 39 ? UNP Q14587 ? ? 'expression tag' 39 10 1 2EOK SER A 40 ? UNP Q14587 ? ? 'expression tag' 40 11 1 2EOK SER A 41 ? UNP Q14587 ? ? 'expression tag' 41 12 1 2EOK GLY A 42 ? UNP Q14587 ? ? 'expression tag' 42 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 201 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 201 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc3 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 29 A ZN 201 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc4 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 104.1 ? 2 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 101.2 ? 3 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 109.4 ? 4 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 115.9 ? 5 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 103.1 ? 6 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 121.9 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? VAL A 12 ? TYR A 11 VAL A 12 A 2 ALA A 19 ? PHE A 20 ? ALA A 19 PHE A 20 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 11 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 20 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 20 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 13 ? ? -47.96 157.53 2 1 HIS A 33 ? ? -86.56 41.94 3 1 VAL A 36 ? ? -52.33 97.85 4 1 SER A 41 ? ? -69.84 80.86 5 2 SER A 5 ? ? -93.19 42.01 6 2 SER A 6 ? ? -34.52 116.26 7 2 CYS A 13 ? ? -39.67 141.15 8 2 ILE A 27 ? ? -39.49 -38.94 9 2 GLN A 30 ? ? -48.59 -19.72 10 3 SER A 3 ? ? -40.16 153.77 11 3 SER A 5 ? ? -168.95 109.73 12 3 GLU A 8 ? ? -64.00 94.26 13 3 LYS A 18 ? ? -64.47 -178.51 14 3 GLN A 30 ? ? -35.94 -35.92 15 3 VAL A 36 ? ? -36.16 145.66 16 4 GLN A 30 ? ? -34.91 -38.68 17 4 THR A 34 ? ? -89.61 38.02 18 4 SER A 41 ? ? -129.80 -60.08 19 5 SER A 2 ? ? -39.73 124.85 20 5 GLN A 30 ? ? -38.11 -36.84 21 5 SER A 41 ? ? 39.68 40.62 22 6 GLN A 30 ? ? -38.07 -27.29 23 7 SER A 6 ? ? -44.44 102.50 24 7 GLU A 8 ? ? -64.36 96.56 25 7 GLN A 30 ? ? -38.05 -29.11 26 7 PRO A 39 ? ? -69.73 2.71 27 9 GLU A 8 ? ? -98.22 41.95 28 9 HIS A 33 ? ? -90.62 40.05 29 9 PRO A 39 ? ? -69.77 92.93 30 10 GLN A 30 ? ? -34.43 -32.96 31 10 ILE A 32 ? ? -39.28 -25.64 32 10 THR A 34 ? ? -61.16 93.64 33 10 SER A 41 ? ? -62.70 86.68 34 12 GLN A 30 ? ? -38.26 -28.16 35 12 ILE A 32 ? ? -39.37 -28.24 36 12 THR A 34 ? ? 34.18 44.40 37 13 SER A 5 ? ? -167.41 110.97 38 13 HIS A 33 ? ? -82.99 37.63 39 14 SER A 5 ? ? -91.21 42.20 40 14 GLN A 30 ? ? -37.23 -27.96 41 14 ILE A 32 ? ? -39.65 -24.97 42 14 HIS A 33 ? ? -90.57 46.54 43 15 SER A 3 ? ? -44.48 162.86 44 15 SER A 6 ? ? -120.87 -55.50 45 15 SER A 14 ? ? -85.35 32.04 46 15 ASP A 15 ? ? -122.17 -51.15 47 15 GLN A 30 ? ? -34.42 -32.39 48 15 ILE A 32 ? ? -39.37 -25.06 49 15 HIS A 33 ? ? -91.53 50.20 50 15 PRO A 39 ? ? -69.80 93.64 51 16 SER A 2 ? ? -91.34 42.17 52 16 SER A 5 ? ? 38.05 42.26 53 16 GLN A 30 ? ? -34.30 -32.62 54 16 ILE A 32 ? ? -39.85 -24.83 55 16 SER A 37 ? ? -64.78 83.15 56 17 SER A 6 ? ? -45.06 97.08 57 17 GLN A 30 ? ? -36.24 -29.42 58 18 SER A 5 ? ? -85.23 46.53 59 18 GLN A 30 ? ? -35.67 -30.32 60 18 VAL A 36 ? ? -162.16 118.23 61 18 PRO A 39 ? ? -69.72 2.36 62 19 SER A 2 ? ? -69.48 83.78 63 19 CYS A 13 ? ? -38.41 138.49 64 19 ASP A 15 ? ? -130.26 -34.39 65 19 GLN A 30 ? ? -36.81 -28.25 66 19 HIS A 33 ? ? -87.66 -73.33 67 20 VAL A 36 ? ? -101.05 79.73 68 20 SER A 37 ? ? 35.49 39.34 69 20 PRO A 39 ? ? -69.73 2.30 70 20 SER A 40 ? ? -37.65 106.98 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2EOK _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EOK # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'about 1.0mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EOK _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 HIS N N N N 93 HIS CA C N S 94 HIS C C N N 95 HIS O O N N 96 HIS CB C N N 97 HIS CG C Y N 98 HIS ND1 N Y N 99 HIS CD2 C Y N 100 HIS CE1 C Y N 101 HIS NE2 N Y N 102 HIS OXT O N N 103 HIS H H N N 104 HIS H2 H N N 105 HIS HA H N N 106 HIS HB2 H N N 107 HIS HB3 H N N 108 HIS HD1 H N N 109 HIS HD2 H N N 110 HIS HE1 H N N 111 HIS HE2 H N N 112 HIS HXT H N N 113 ILE N N N N 114 ILE CA C N S 115 ILE C C N N 116 ILE O O N N 117 ILE CB C N S 118 ILE CG1 C N N 119 ILE CG2 C N N 120 ILE CD1 C N N 121 ILE OXT O N N 122 ILE H H N N 123 ILE H2 H N N 124 ILE HA H N N 125 ILE HB H N N 126 ILE HG12 H N N 127 ILE HG13 H N N 128 ILE HG21 H N N 129 ILE HG22 H N N 130 ILE HG23 H N N 131 ILE HD11 H N N 132 ILE HD12 H N N 133 ILE HD13 H N N 134 ILE HXT H N N 135 LEU N N N N 136 LEU CA C N S 137 LEU C C N N 138 LEU O O N N 139 LEU CB C N N 140 LEU CG C N N 141 LEU CD1 C N N 142 LEU CD2 C N N 143 LEU OXT O N N 144 LEU H H N N 145 LEU H2 H N N 146 LEU HA H N N 147 LEU HB2 H N N 148 LEU HB3 H N N 149 LEU HG H N N 150 LEU HD11 H N N 151 LEU HD12 H N N 152 LEU HD13 H N N 153 LEU HD21 H N N 154 LEU HD22 H N N 155 LEU HD23 H N N 156 LEU HXT H N N 157 LYS N N N N 158 LYS CA C N S 159 LYS C C N N 160 LYS O O N N 161 LYS CB C N N 162 LYS CG C N N 163 LYS CD C N N 164 LYS CE C N N 165 LYS NZ N N N 166 LYS OXT O N N 167 LYS H H N N 168 LYS H2 H N N 169 LYS HA H N N 170 LYS HB2 H N N 171 LYS HB3 H N N 172 LYS HG2 H N N 173 LYS HG3 H N N 174 LYS HD2 H N N 175 LYS HD3 H N N 176 LYS HE2 H N N 177 LYS HE3 H N N 178 LYS HZ1 H N N 179 LYS HZ2 H N N 180 LYS HZ3 H N N 181 LYS HXT H N N 182 PHE N N N N 183 PHE CA C N S 184 PHE C C N N 185 PHE O O N N 186 PHE CB C N N 187 PHE CG C Y N 188 PHE CD1 C Y N 189 PHE CD2 C Y N 190 PHE CE1 C Y N 191 PHE CE2 C Y N 192 PHE CZ C Y N 193 PHE OXT O N N 194 PHE H H N N 195 PHE H2 H N N 196 PHE HA H N N 197 PHE HB2 H N N 198 PHE HB3 H N N 199 PHE HD1 H N N 200 PHE HD2 H N N 201 PHE HE1 H N N 202 PHE HE2 H N N 203 PHE HZ H N N 204 PHE HXT H N N 205 PRO N N N N 206 PRO CA C N S 207 PRO C C N N 208 PRO O O N N 209 PRO CB C N N 210 PRO CG C N N 211 PRO CD C N N 212 PRO OXT O N N 213 PRO H H N N 214 PRO HA H N N 215 PRO HB2 H N N 216 PRO HB3 H N N 217 PRO HG2 H N N 218 PRO HG3 H N N 219 PRO HD2 H N N 220 PRO HD3 H N N 221 PRO HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TYR N N N N 254 TYR CA C N S 255 TYR C C N N 256 TYR O O N N 257 TYR CB C N N 258 TYR CG C Y N 259 TYR CD1 C Y N 260 TYR CD2 C Y N 261 TYR CE1 C Y N 262 TYR CE2 C Y N 263 TYR CZ C Y N 264 TYR OH O N N 265 TYR OXT O N N 266 TYR H H N N 267 TYR H2 H N N 268 TYR HA H N N 269 TYR HB2 H N N 270 TYR HB3 H N N 271 TYR HD1 H N N 272 TYR HD2 H N N 273 TYR HE1 H N N 274 TYR HE2 H N N 275 TYR HH H N N 276 TYR HXT H N N 277 VAL N N N N 278 VAL CA C N S 279 VAL C C N N 280 VAL O O N N 281 VAL CB C N N 282 VAL CG1 C N N 283 VAL CG2 C N N 284 VAL OXT O N N 285 VAL H H N N 286 VAL H2 H N N 287 VAL HA H N N 288 VAL HB H N N 289 VAL HG11 H N N 290 VAL HG12 H N N 291 VAL HG13 H N N 292 VAL HG21 H N N 293 VAL HG22 H N N 294 VAL HG23 H N N 295 VAL HXT H N N 296 ZN ZN ZN N N 297 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 HIS N CA sing N N 87 HIS N H sing N N 88 HIS N H2 sing N N 89 HIS CA C sing N N 90 HIS CA CB sing N N 91 HIS CA HA sing N N 92 HIS C O doub N N 93 HIS C OXT sing N N 94 HIS CB CG sing N N 95 HIS CB HB2 sing N N 96 HIS CB HB3 sing N N 97 HIS CG ND1 sing Y N 98 HIS CG CD2 doub Y N 99 HIS ND1 CE1 doub Y N 100 HIS ND1 HD1 sing N N 101 HIS CD2 NE2 sing Y N 102 HIS CD2 HD2 sing N N 103 HIS CE1 NE2 sing Y N 104 HIS CE1 HE1 sing N N 105 HIS NE2 HE2 sing N N 106 HIS OXT HXT sing N N 107 ILE N CA sing N N 108 ILE N H sing N N 109 ILE N H2 sing N N 110 ILE CA C sing N N 111 ILE CA CB sing N N 112 ILE CA HA sing N N 113 ILE C O doub N N 114 ILE C OXT sing N N 115 ILE CB CG1 sing N N 116 ILE CB CG2 sing N N 117 ILE CB HB sing N N 118 ILE CG1 CD1 sing N N 119 ILE CG1 HG12 sing N N 120 ILE CG1 HG13 sing N N 121 ILE CG2 HG21 sing N N 122 ILE CG2 HG22 sing N N 123 ILE CG2 HG23 sing N N 124 ILE CD1 HD11 sing N N 125 ILE CD1 HD12 sing N N 126 ILE CD1 HD13 sing N N 127 ILE OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 PHE N CA sing N N 174 PHE N H sing N N 175 PHE N H2 sing N N 176 PHE CA C sing N N 177 PHE CA CB sing N N 178 PHE CA HA sing N N 179 PHE C O doub N N 180 PHE C OXT sing N N 181 PHE CB CG sing N N 182 PHE CB HB2 sing N N 183 PHE CB HB3 sing N N 184 PHE CG CD1 doub Y N 185 PHE CG CD2 sing Y N 186 PHE CD1 CE1 sing Y N 187 PHE CD1 HD1 sing N N 188 PHE CD2 CE2 doub Y N 189 PHE CD2 HD2 sing N N 190 PHE CE1 CZ doub Y N 191 PHE CE1 HE1 sing N N 192 PHE CE2 CZ sing Y N 193 PHE CE2 HE2 sing N N 194 PHE CZ HZ sing N N 195 PHE OXT HXT sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TYR N CA sing N N 243 TYR N H sing N N 244 TYR N H2 sing N N 245 TYR CA C sing N N 246 TYR CA CB sing N N 247 TYR CA HA sing N N 248 TYR C O doub N N 249 TYR C OXT sing N N 250 TYR CB CG sing N N 251 TYR CB HB2 sing N N 252 TYR CB HB3 sing N N 253 TYR CG CD1 doub Y N 254 TYR CG CD2 sing Y N 255 TYR CD1 CE1 sing Y N 256 TYR CD1 HD1 sing N N 257 TYR CD2 CE2 doub Y N 258 TYR CD2 HD2 sing N N 259 TYR CE1 CZ doub Y N 260 TYR CE1 HE1 sing N N 261 TYR CE2 CZ sing Y N 262 TYR CE2 HE2 sing N N 263 TYR CZ OH sing N N 264 TYR OH HH sing N N 265 TYR OXT HXT sing N N 266 VAL N CA sing N N 267 VAL N H sing N N 268 VAL N H2 sing N N 269 VAL CA C sing N N 270 VAL CA CB sing N N 271 VAL CA HA sing N N 272 VAL C O doub N N 273 VAL C OXT sing N N 274 VAL CB CG1 sing N N 275 VAL CB CG2 sing N N 276 VAL CB HB sing N N 277 VAL CG1 HG11 sing N N 278 VAL CG1 HG12 sing N N 279 VAL CG1 HG13 sing N N 280 VAL CG2 HG21 sing N N 281 VAL CG2 HG22 sing N N 282 VAL CG2 HG23 sing N N 283 VAL OXT HXT sing N N 284 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EOK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_