data_2EPS # _entry.id 2EPS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EPS pdb_00002eps 10.2210/pdb2eps/pdb RCSB RCSB026957 ? ? WWPDB D_1000026957 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EPS _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002013231.4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the 4th zinc finger domain of Zinc finger protein 278' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'POZ-, AT hook-, and zinc finger-containing protein 1' 5647.267 1 ? ? 'zinc finger domain, UNP residues 408-448' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Zinc finger protein 278, Zinc finger sarcoma gene protein, BTB-POZ domain zinc finger transcription factor, Protein kinase A RI-subunit alpha- associated protein, Zinc finger and BTB domain-containing protein 19 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQVWVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQVWVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002013231.4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 VAL n 1 10 GLY n 1 11 LYS n 1 12 PRO n 1 13 TYR n 1 14 ILE n 1 15 CYS n 1 16 GLN n 1 17 SER n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 GLY n 1 22 PHE n 1 23 SER n 1 24 ARG n 1 25 PRO n 1 26 ASP n 1 27 HIS n 1 28 LEU n 1 29 ASN n 1 30 GLY n 1 31 HIS n 1 32 ILE n 1 33 LYS n 1 34 GLN n 1 35 VAL n 1 36 HIS n 1 37 THR n 1 38 SER n 1 39 GLU n 1 40 ARG n 1 41 PRO n 1 42 HIS n 1 43 LYS n 1 44 CYS n 1 45 GLN n 1 46 VAL n 1 47 TRP n 1 48 VAL n 1 49 SER n 1 50 GLY n 1 51 PRO n 1 52 SER n 1 53 SER n 1 54 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PATZ1, PATZ, RIAZ, ZBTB19, ZNF278, ZSG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061204-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 401 401 GLY GLY A . n A 1 2 SER 2 402 402 SER SER A . n A 1 3 SER 3 403 403 SER SER A . n A 1 4 GLY 4 404 404 GLY GLY A . n A 1 5 SER 5 405 405 SER SER A . n A 1 6 SER 6 406 406 SER SER A . n A 1 7 GLY 7 407 407 GLY GLY A . n A 1 8 SER 8 408 408 SER SER A . n A 1 9 VAL 9 409 409 VAL VAL A . n A 1 10 GLY 10 410 410 GLY GLY A . n A 1 11 LYS 11 411 411 LYS LYS A . n A 1 12 PRO 12 412 412 PRO PRO A . n A 1 13 TYR 13 413 413 TYR TYR A . n A 1 14 ILE 14 414 414 ILE ILE A . n A 1 15 CYS 15 415 415 CYS CYS A . n A 1 16 GLN 16 416 416 GLN GLN A . n A 1 17 SER 17 417 417 SER SER A . n A 1 18 CYS 18 418 418 CYS CYS A . n A 1 19 GLY 19 419 419 GLY GLY A . n A 1 20 LYS 20 420 420 LYS LYS A . n A 1 21 GLY 21 421 421 GLY GLY A . n A 1 22 PHE 22 422 422 PHE PHE A . n A 1 23 SER 23 423 423 SER SER A . n A 1 24 ARG 24 424 424 ARG ARG A . n A 1 25 PRO 25 425 425 PRO PRO A . n A 1 26 ASP 26 426 426 ASP ASP A . n A 1 27 HIS 27 427 427 HIS HIS A . n A 1 28 LEU 28 428 428 LEU LEU A . n A 1 29 ASN 29 429 429 ASN ASN A . n A 1 30 GLY 30 430 430 GLY GLY A . n A 1 31 HIS 31 431 431 HIS HIS A . n A 1 32 ILE 32 432 432 ILE ILE A . n A 1 33 LYS 33 433 433 LYS LYS A . n A 1 34 GLN 34 434 434 GLN GLN A . n A 1 35 VAL 35 435 435 VAL VAL A . n A 1 36 HIS 36 436 436 HIS HIS A . n A 1 37 THR 37 437 437 THR THR A . n A 1 38 SER 38 438 438 SER SER A . n A 1 39 GLU 39 439 439 GLU GLU A . n A 1 40 ARG 40 440 440 ARG ARG A . n A 1 41 PRO 41 441 441 PRO PRO A . n A 1 42 HIS 42 442 442 HIS HIS A . n A 1 43 LYS 43 443 443 LYS LYS A . n A 1 44 CYS 44 444 444 CYS CYS A . n A 1 45 GLN 45 445 445 GLN GLN A . n A 1 46 VAL 46 446 446 VAL VAL A . n A 1 47 TRP 47 447 447 TRP TRP A . n A 1 48 VAL 48 448 448 VAL VAL A . n A 1 49 SER 49 449 449 SER SER A . n A 1 50 GLY 50 450 450 GLY GLY A . n A 1 51 PRO 51 451 451 PRO PRO A . n A 1 52 SER 52 452 452 SER SER A . n A 1 53 SER 53 453 453 SER SER A . n A 1 54 GLY 54 454 454 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2EPS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EPS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EPS _struct.title 'Solution structure of the 4th zinc finger domain of Zinc finger protein 278' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EPS _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PATZ1_HUMAN _struct_ref.pdbx_db_accession Q9HBE1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQ _struct_ref.pdbx_align_begin 408 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EPS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HBE1 _struct_ref_seq.db_align_beg 408 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 445 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 408 _struct_ref_seq.pdbx_auth_seq_align_end 445 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EPS GLY A 1 ? UNP Q9HBE1 ? ? 'expression tag' 401 1 1 2EPS SER A 2 ? UNP Q9HBE1 ? ? 'expression tag' 402 2 1 2EPS SER A 3 ? UNP Q9HBE1 ? ? 'expression tag' 403 3 1 2EPS GLY A 4 ? UNP Q9HBE1 ? ? 'expression tag' 404 4 1 2EPS SER A 5 ? UNP Q9HBE1 ? ? 'expression tag' 405 5 1 2EPS SER A 6 ? UNP Q9HBE1 ? ? 'expression tag' 406 6 1 2EPS GLY A 7 ? UNP Q9HBE1 ? ? 'expression tag' 407 7 1 2EPS VAL A 46 ? UNP Q9HBE1 ? ? 'SEE REMARK 999' 446 8 1 2EPS TRP A 47 ? UNP Q9HBE1 ? ? 'SEE REMARK 999' 447 9 1 2EPS VAL A 48 ? UNP Q9HBE1 ? ? 'SEE REMARK 999' 448 10 1 2EPS SER A 49 ? UNP Q9HBE1 ? ? 'expression tag' 449 11 1 2EPS GLY A 50 ? UNP Q9HBE1 ? ? 'expression tag' 450 12 1 2EPS PRO A 51 ? UNP Q9HBE1 ? ? 'expression tag' 451 13 1 2EPS SER A 52 ? UNP Q9HBE1 ? ? 'expression tag' 452 14 1 2EPS SER A 53 ? UNP Q9HBE1 ? ? 'expression tag' 453 15 1 2EPS GLY A 54 ? UNP Q9HBE1 ? ? 'expression tag' 454 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 424 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 435 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 15 SG ? ? A ZN 201 A CYS 415 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG ? ? A ZN 201 A CYS 418 1_555 ? ? ? ? ? ? ? 2.225 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 31 NE2 ? ? A ZN 201 A HIS 431 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 36 NE2 ? ? A ZN 201 A HIS 436 1_555 ? ? ? ? ? ? ? 1.917 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 415 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 18 ? A CYS 418 ? 1_555 117.3 ? 2 SG ? A CYS 15 ? A CYS 415 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 431 ? 1_555 108.5 ? 3 SG ? A CYS 18 ? A CYS 418 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 431 ? 1_555 106.7 ? 4 SG ? A CYS 15 ? A CYS 415 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 36 ? A HIS 436 ? 1_555 109.6 ? 5 SG ? A CYS 18 ? A CYS 418 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 36 ? A HIS 436 ? 1_555 107.3 ? 6 NE2 ? A HIS 31 ? A HIS 431 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 36 ? A HIS 436 ? 1_555 107.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 13 ? ILE A 14 ? TYR A 413 ILE A 414 A 2 GLY A 21 ? PHE A 22 ? GLY A 421 PHE A 422 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 413 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 422 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 413 ? ? -59.04 94.01 2 1 LYS A 420 ? ? -50.99 179.48 3 1 LYS A 443 ? ? -57.06 174.57 4 1 CYS A 444 ? ? -80.94 42.37 5 2 SER A 405 ? ? -133.38 -46.53 6 2 TYR A 413 ? ? -61.44 93.40 7 2 LYS A 420 ? ? -58.19 179.95 8 2 PRO A 441 ? ? -69.78 98.27 9 3 TYR A 413 ? ? -62.46 95.30 10 3 LYS A 420 ? ? -54.24 174.72 11 3 SER A 438 ? ? -47.88 99.59 12 3 VAL A 448 ? ? -34.37 109.07 13 3 SER A 452 ? ? -82.73 41.67 14 4 SER A 402 ? ? -45.10 161.00 15 4 TYR A 413 ? ? -60.38 94.13 16 4 LYS A 420 ? ? -58.25 178.08 17 4 PRO A 441 ? ? -69.69 -169.35 18 5 TYR A 413 ? ? -62.76 94.80 19 5 SER A 417 ? ? -122.98 -66.41 20 5 LYS A 420 ? ? -65.37 -179.48 21 5 PRO A 441 ? ? -69.82 -171.89 22 5 CYS A 444 ? ? -43.34 162.10 23 5 TRP A 447 ? ? -166.50 116.96 24 5 VAL A 448 ? ? 33.56 40.73 25 5 SER A 453 ? ? -81.36 48.26 26 6 SER A 405 ? ? -166.82 108.92 27 6 TYR A 413 ? ? -63.31 97.18 28 6 LYS A 420 ? ? -64.63 -179.40 29 6 PRO A 441 ? ? -69.72 -176.69 30 6 HIS A 442 ? ? -57.97 102.36 31 7 VAL A 409 ? ? 37.98 27.50 32 7 TYR A 413 ? ? -61.25 93.98 33 7 LYS A 420 ? ? -55.48 -179.67 34 7 HIS A 442 ? ? -35.17 147.65 35 7 CYS A 444 ? ? -58.78 96.71 36 7 GLN A 445 ? ? -54.60 108.66 37 8 SER A 403 ? ? -89.75 42.50 38 8 SER A 408 ? ? -97.25 42.66 39 8 TYR A 413 ? ? -60.74 89.87 40 8 LYS A 420 ? ? -55.97 176.24 41 8 THR A 437 ? ? -67.53 88.63 42 8 PRO A 441 ? ? -69.77 84.21 43 8 SER A 449 ? ? -52.50 174.21 44 8 PRO A 451 ? ? -69.78 2.91 45 8 SER A 452 ? ? -39.48 159.36 46 9 SER A 402 ? ? -91.82 42.19 47 9 TYR A 413 ? ? -60.21 95.49 48 9 LYS A 420 ? ? -62.81 -179.52 49 9 SER A 438 ? ? -34.55 148.89 50 10 VAL A 409 ? ? -173.48 141.01 51 10 TYR A 413 ? ? -60.32 90.60 52 10 LYS A 420 ? ? -52.69 179.88 53 10 LYS A 443 ? ? -103.97 73.53 54 10 CYS A 444 ? ? -168.77 105.29 55 10 VAL A 448 ? ? -34.09 137.68 56 10 PRO A 451 ? ? -69.80 2.94 57 10 SER A 452 ? ? -34.32 130.85 58 11 LYS A 411 ? ? -50.82 107.56 59 11 TYR A 413 ? ? -58.54 90.17 60 11 LYS A 420 ? ? -46.34 170.93 61 11 HIS A 442 ? ? -51.54 103.49 62 11 LYS A 443 ? ? -166.80 111.88 63 11 CYS A 444 ? ? -34.80 127.95 64 11 TRP A 447 ? ? -131.98 -40.64 65 12 SER A 402 ? ? -84.21 45.73 66 12 SER A 405 ? ? -66.60 91.97 67 12 VAL A 409 ? ? 34.33 39.38 68 12 TYR A 413 ? ? -62.41 97.88 69 12 LYS A 420 ? ? -64.31 -179.75 70 12 SER A 438 ? ? 73.12 51.92 71 12 PRO A 441 ? ? -69.78 0.44 72 12 LYS A 443 ? ? -80.61 48.00 73 12 GLN A 445 ? ? -110.02 79.94 74 12 PRO A 451 ? ? -69.76 2.15 75 12 SER A 452 ? ? -34.65 102.39 76 12 SER A 453 ? ? -107.10 49.35 77 13 SER A 405 ? ? -171.98 133.90 78 13 VAL A 409 ? ? 29.03 46.97 79 13 TYR A 413 ? ? -62.67 95.90 80 13 LYS A 420 ? ? -62.87 -179.79 81 13 CYS A 444 ? ? -55.90 109.01 82 13 VAL A 448 ? ? -34.40 128.91 83 13 PRO A 451 ? ? -69.73 92.75 84 13 SER A 453 ? ? -35.36 113.21 85 14 TYR A 413 ? ? -61.02 90.82 86 14 HIS A 442 ? ? -108.08 42.89 87 14 VAL A 448 ? ? -34.42 98.05 88 14 PRO A 451 ? ? -69.72 98.57 89 14 SER A 452 ? ? -81.85 40.90 90 15 SER A 405 ? ? -171.82 145.87 91 15 TYR A 413 ? ? -60.92 93.69 92 15 LYS A 420 ? ? -51.67 179.23 93 15 PRO A 441 ? ? -69.78 90.44 94 15 CYS A 444 ? ? -64.17 82.72 95 15 GLN A 445 ? ? -90.06 38.63 96 16 TYR A 413 ? ? -59.20 94.10 97 16 LYS A 420 ? ? -55.12 173.75 98 16 THR A 437 ? ? -33.90 146.68 99 16 PRO A 441 ? ? -69.76 92.69 100 16 LYS A 443 ? ? 34.84 44.00 101 16 VAL A 448 ? ? -59.69 -178.22 102 17 LYS A 411 ? ? -48.16 105.65 103 17 TYR A 413 ? ? -60.09 91.56 104 17 LYS A 420 ? ? -51.29 176.17 105 17 GLU A 439 ? ? -37.22 141.90 106 17 GLN A 445 ? ? -84.33 44.16 107 17 SER A 449 ? ? -45.17 155.78 108 18 TYR A 413 ? ? -58.57 92.76 109 18 LYS A 420 ? ? -50.43 175.25 110 18 VAL A 448 ? ? -35.47 100.10 111 18 PRO A 451 ? ? -69.71 92.81 112 19 TYR A 413 ? ? -62.14 96.98 113 19 LYS A 420 ? ? -58.97 179.11 114 19 HIS A 442 ? ? -40.39 104.41 115 19 VAL A 448 ? ? -98.88 46.62 116 20 SER A 402 ? ? -82.70 44.46 117 20 SER A 403 ? ? -82.54 41.86 118 20 TYR A 413 ? ? -60.92 94.09 119 20 LYS A 420 ? ? -55.09 172.54 120 20 GLU A 439 ? ? -172.13 125.78 121 20 PRO A 441 ? ? -69.77 -177.52 122 20 HIS A 442 ? ? -37.37 113.28 123 20 VAL A 448 ? ? -35.25 142.53 124 20 PRO A 451 ? ? -69.70 87.68 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE This difference is based on Reference 4 in the database, Q9HBE1. ; # _pdbx_nmr_ensemble.entry_id 2EPS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EPS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.08mM 13C-15N PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EPS _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TRP N N N N 285 TRP CA C N S 286 TRP C C N N 287 TRP O O N N 288 TRP CB C N N 289 TRP CG C Y N 290 TRP CD1 C Y N 291 TRP CD2 C Y N 292 TRP NE1 N Y N 293 TRP CE2 C Y N 294 TRP CE3 C Y N 295 TRP CZ2 C Y N 296 TRP CZ3 C Y N 297 TRP CH2 C Y N 298 TRP OXT O N N 299 TRP H H N N 300 TRP H2 H N N 301 TRP HA H N N 302 TRP HB2 H N N 303 TRP HB3 H N N 304 TRP HD1 H N N 305 TRP HE1 H N N 306 TRP HE3 H N N 307 TRP HZ2 H N N 308 TRP HZ3 H N N 309 TRP HH2 H N N 310 TRP HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 ZN ZN ZN N N 355 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TRP N CA sing N N 273 TRP N H sing N N 274 TRP N H2 sing N N 275 TRP CA C sing N N 276 TRP CA CB sing N N 277 TRP CA HA sing N N 278 TRP C O doub N N 279 TRP C OXT sing N N 280 TRP CB CG sing N N 281 TRP CB HB2 sing N N 282 TRP CB HB3 sing N N 283 TRP CG CD1 doub Y N 284 TRP CG CD2 sing Y N 285 TRP CD1 NE1 sing Y N 286 TRP CD1 HD1 sing N N 287 TRP CD2 CE2 doub Y N 288 TRP CD2 CE3 sing Y N 289 TRP NE1 CE2 sing Y N 290 TRP NE1 HE1 sing N N 291 TRP CE2 CZ2 sing Y N 292 TRP CE3 CZ3 doub Y N 293 TRP CE3 HE3 sing N N 294 TRP CZ2 CH2 doub Y N 295 TRP CZ2 HZ2 sing N N 296 TRP CZ3 CH2 sing Y N 297 TRP CZ3 HZ3 sing N N 298 TRP CH2 HH2 sing N N 299 TRP OXT HXT sing N N 300 TYR N CA sing N N 301 TYR N H sing N N 302 TYR N H2 sing N N 303 TYR CA C sing N N 304 TYR CA CB sing N N 305 TYR CA HA sing N N 306 TYR C O doub N N 307 TYR C OXT sing N N 308 TYR CB CG sing N N 309 TYR CB HB2 sing N N 310 TYR CB HB3 sing N N 311 TYR CG CD1 doub Y N 312 TYR CG CD2 sing Y N 313 TYR CD1 CE1 sing Y N 314 TYR CD1 HD1 sing N N 315 TYR CD2 CE2 doub Y N 316 TYR CD2 HD2 sing N N 317 TYR CE1 CZ doub Y N 318 TYR CE1 HE1 sing N N 319 TYR CE2 CZ sing Y N 320 TYR CE2 HE2 sing N N 321 TYR CZ OH sing N N 322 TYR OH HH sing N N 323 TYR OXT HXT sing N N 324 VAL N CA sing N N 325 VAL N H sing N N 326 VAL N H2 sing N N 327 VAL CA C sing N N 328 VAL CA CB sing N N 329 VAL CA HA sing N N 330 VAL C O doub N N 331 VAL C OXT sing N N 332 VAL CB CG1 sing N N 333 VAL CB CG2 sing N N 334 VAL CB HB sing N N 335 VAL CG1 HG11 sing N N 336 VAL CG1 HG12 sing N N 337 VAL CG1 HG13 sing N N 338 VAL CG2 HG21 sing N N 339 VAL CG2 HG22 sing N N 340 VAL CG2 HG23 sing N N 341 VAL OXT HXT sing N N 342 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EPS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_