data_2EPV # _entry.id 2EPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EPV pdb_00002epv 10.2210/pdb2epv/pdb RCSB RCSB026960 ? ? WWPDB D_1000026960 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EPV _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003011774.21 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the 20th C2H2 type zinc finger domain of Zinc finger protein 268' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 268' 4500.939 1 ? ? 'zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein HZF3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSGEKPYECNECGKAFIWKSLLIVHERTHAGVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSGEKPYECNECGKAFIWKSLLIVHERTHAGVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003011774.21 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 GLY n 1 10 GLU n 1 11 LYS n 1 12 PRO n 1 13 TYR n 1 14 GLU n 1 15 CYS n 1 16 ASN n 1 17 GLU n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 ALA n 1 22 PHE n 1 23 ILE n 1 24 TRP n 1 25 LYS n 1 26 SER n 1 27 LEU n 1 28 LEU n 1 29 ILE n 1 30 VAL n 1 31 HIS n 1 32 GLU n 1 33 ARG n 1 34 THR n 1 35 HIS n 1 36 ALA n 1 37 GLY n 1 38 VAL n 1 39 SER n 1 40 GLY n 1 41 PRO n 1 42 SER n 1 43 SER n 1 44 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF268 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061218-20 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 796 796 GLY GLY A . n A 1 2 SER 2 797 797 SER SER A . n A 1 3 SER 3 798 798 SER SER A . n A 1 4 GLY 4 799 799 GLY GLY A . n A 1 5 SER 5 800 800 SER SER A . n A 1 6 SER 6 801 801 SER SER A . n A 1 7 GLY 7 802 802 GLY GLY A . n A 1 8 SER 8 803 803 SER SER A . n A 1 9 GLY 9 804 804 GLY GLY A . n A 1 10 GLU 10 805 805 GLU GLU A . n A 1 11 LYS 11 806 806 LYS LYS A . n A 1 12 PRO 12 807 807 PRO PRO A . n A 1 13 TYR 13 808 808 TYR TYR A . n A 1 14 GLU 14 809 809 GLU GLU A . n A 1 15 CYS 15 810 810 CYS CYS A . n A 1 16 ASN 16 811 811 ASN ASN A . n A 1 17 GLU 17 812 812 GLU GLU A . n A 1 18 CYS 18 813 813 CYS CYS A . n A 1 19 GLY 19 814 814 GLY GLY A . n A 1 20 LYS 20 815 815 LYS LYS A . n A 1 21 ALA 21 816 816 ALA ALA A . n A 1 22 PHE 22 817 817 PHE PHE A . n A 1 23 ILE 23 818 818 ILE ILE A . n A 1 24 TRP 24 819 819 TRP TRP A . n A 1 25 LYS 25 820 820 LYS LYS A . n A 1 26 SER 26 821 821 SER SER A . n A 1 27 LEU 27 822 822 LEU LEU A . n A 1 28 LEU 28 823 823 LEU LEU A . n A 1 29 ILE 29 824 824 ILE ILE A . n A 1 30 VAL 30 825 825 VAL VAL A . n A 1 31 HIS 31 826 826 HIS HIS A . n A 1 32 GLU 32 827 827 GLU GLU A . n A 1 33 ARG 33 828 828 ARG ARG A . n A 1 34 THR 34 829 829 THR THR A . n A 1 35 HIS 35 830 830 HIS HIS A . n A 1 36 ALA 36 831 831 ALA ALA A . n A 1 37 GLY 37 832 832 GLY GLY A . n A 1 38 VAL 38 833 833 VAL VAL A . n A 1 39 SER 39 834 834 SER SER A . n A 1 40 GLY 40 835 835 GLY GLY A . n A 1 41 PRO 41 836 836 PRO PRO A . n A 1 42 SER 42 837 837 SER SER A . n A 1 43 SER 43 838 838 SER SER A . n A 1 44 GLY 44 839 839 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2EPV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EPV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EPV _struct.title 'Solution structure of the 20th C2H2 type zinc finger domain of Zinc finger protein 268' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EPV _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN268_HUMAN _struct_ref.pdbx_db_accession Q14587 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SGEKPYECNECGKAFIWKSLLIVHERTHAGV _struct_ref.pdbx_align_begin 803 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14587 _struct_ref_seq.db_align_beg 803 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 833 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 803 _struct_ref_seq.pdbx_auth_seq_align_end 833 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EPV GLY A 1 ? UNP Q14587 ? ? 'expression tag' 796 1 1 2EPV SER A 2 ? UNP Q14587 ? ? 'expression tag' 797 2 1 2EPV SER A 3 ? UNP Q14587 ? ? 'expression tag' 798 3 1 2EPV GLY A 4 ? UNP Q14587 ? ? 'expression tag' 799 4 1 2EPV SER A 5 ? UNP Q14587 ? ? 'expression tag' 800 5 1 2EPV SER A 6 ? UNP Q14587 ? ? 'expression tag' 801 6 1 2EPV GLY A 7 ? UNP Q14587 ? ? 'expression tag' 802 7 1 2EPV SER A 39 ? UNP Q14587 ? ? 'expression tag' 834 8 1 2EPV GLY A 40 ? UNP Q14587 ? ? 'expression tag' 835 9 1 2EPV PRO A 41 ? UNP Q14587 ? ? 'expression tag' 836 10 1 2EPV SER A 42 ? UNP Q14587 ? ? 'expression tag' 837 11 1 2EPV SER A 43 ? UNP Q14587 ? ? 'expression tag' 838 12 1 2EPV GLY A 44 ? UNP Q14587 ? ? 'expression tag' 839 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 24 ? ARG A 33 ? TRP A 819 ARG A 828 1 ? 10 HELX_P HELX_P2 2 THR A 34 ? ALA A 36 ? THR A 829 ALA A 831 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 15 SG ? ? A ZN 201 A CYS 810 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG ? ? A ZN 201 A CYS 813 1_555 ? ? ? ? ? ? ? 2.220 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 31 NE2 ? ? A ZN 201 A HIS 826 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 35 NE2 ? ? A ZN 201 A HIS 830 1_555 ? ? ? ? ? ? ? 2.057 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 810 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 18 ? A CYS 813 ? 1_555 114.0 ? 2 SG ? A CYS 15 ? A CYS 810 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 826 ? 1_555 100.1 ? 3 SG ? A CYS 18 ? A CYS 813 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 826 ? 1_555 101.2 ? 4 SG ? A CYS 15 ? A CYS 810 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 830 ? 1_555 114.1 ? 5 SG ? A CYS 18 ? A CYS 813 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 830 ? 1_555 112.9 ? 6 NE2 ? A HIS 31 ? A HIS 826 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 830 ? 1_555 113.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 13 ? GLU A 14 ? TYR A 808 GLU A 809 A 2 ALA A 21 ? PHE A 22 ? ALA A 816 PHE A 817 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 808 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 817 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 798 ? ? -84.05 42.42 2 1 CYS A 810 ? ? -37.95 152.84 3 1 LYS A 815 ? ? -56.31 174.41 4 1 GLU A 827 ? ? -39.18 -36.12 5 1 THR A 829 ? ? -38.39 -26.63 6 1 HIS A 830 ? ? -89.43 43.50 7 1 PRO A 836 ? ? -69.78 91.54 8 1 SER A 837 ? ? -90.69 41.68 9 2 CYS A 810 ? ? -36.59 151.80 10 2 ALA A 831 ? ? -85.16 44.71 11 3 SER A 797 ? ? 39.43 42.19 12 3 CYS A 810 ? ? -44.84 153.30 13 3 LYS A 815 ? ? -53.09 173.83 14 3 THR A 829 ? ? -39.16 -37.67 15 3 HIS A 830 ? ? -81.91 40.42 16 4 SER A 803 ? ? -104.22 41.53 17 4 CYS A 810 ? ? -39.02 152.10 18 4 HIS A 830 ? ? -83.81 35.10 19 4 ALA A 831 ? ? -108.59 45.27 20 4 SER A 838 ? ? -35.04 140.65 21 5 SER A 803 ? ? -35.71 116.21 22 5 GLU A 809 ? ? -166.09 107.78 23 5 CYS A 810 ? ? -35.42 152.84 24 5 HIS A 830 ? ? -88.36 39.49 25 5 PRO A 836 ? ? -69.75 2.83 26 6 CYS A 810 ? ? -39.02 159.06 27 6 SER A 834 ? ? -109.68 41.45 28 7 SER A 798 ? ? -55.82 95.25 29 7 GLU A 805 ? ? 39.08 50.51 30 7 CYS A 810 ? ? -41.90 153.89 31 7 LYS A 815 ? ? -54.55 175.81 32 7 HIS A 826 ? ? -90.02 -60.23 33 7 THR A 829 ? ? -39.07 -35.52 34 7 HIS A 830 ? ? -78.85 47.23 35 7 PRO A 836 ? ? -69.79 0.36 36 8 SER A 803 ? ? -92.74 42.53 37 8 CYS A 810 ? ? -41.36 156.45 38 8 LYS A 815 ? ? -50.21 171.98 39 9 SER A 801 ? ? -69.99 93.02 40 9 CYS A 810 ? ? -45.14 156.37 41 9 LYS A 815 ? ? -55.63 173.85 42 10 CYS A 810 ? ? -39.04 151.95 43 10 LYS A 815 ? ? -57.44 174.90 44 10 HIS A 826 ? ? -92.42 -60.28 45 11 SER A 801 ? ? -36.59 151.21 46 11 LYS A 815 ? ? -50.24 176.20 47 11 GLU A 827 ? ? -39.95 -35.64 48 11 HIS A 830 ? ? -81.57 41.44 49 12 CYS A 810 ? ? -35.79 153.34 50 12 LYS A 815 ? ? -53.78 174.70 51 12 HIS A 830 ? ? -85.11 39.09 52 13 CYS A 810 ? ? -44.52 155.34 53 13 GLU A 827 ? ? -38.87 -39.32 54 13 ALA A 831 ? ? -44.58 100.41 55 13 VAL A 833 ? ? -37.26 137.36 56 14 SER A 800 ? ? -91.62 -60.01 57 14 SER A 801 ? ? 39.50 42.22 58 14 CYS A 810 ? ? -34.37 151.26 59 14 LYS A 815 ? ? -55.93 176.39 60 14 HIS A 830 ? ? -84.87 34.42 61 14 SER A 834 ? ? 34.02 41.95 62 15 SER A 803 ? ? 37.67 42.12 63 15 CYS A 810 ? ? -37.84 153.18 64 15 LYS A 815 ? ? -56.51 175.70 65 15 HIS A 830 ? ? -83.36 39.91 66 15 PRO A 836 ? ? -69.74 2.78 67 15 SER A 838 ? ? -55.57 99.74 68 16 CYS A 810 ? ? -48.53 154.76 69 16 LYS A 815 ? ? -53.76 175.02 70 16 THR A 829 ? ? -38.52 -38.61 71 17 CYS A 810 ? ? -41.51 156.13 72 17 LYS A 815 ? ? -55.09 176.70 73 18 CYS A 810 ? ? -36.03 152.73 74 18 LYS A 815 ? ? -54.32 173.42 75 18 HIS A 830 ? ? -92.55 43.32 76 18 VAL A 833 ? ? -82.95 40.09 77 19 SER A 803 ? ? -123.08 -50.52 78 19 CYS A 810 ? ? -35.45 152.84 79 19 ALA A 831 ? ? -38.59 105.14 80 19 VAL A 833 ? ? -84.10 39.83 81 20 CYS A 810 ? ? -39.53 153.52 82 20 LYS A 815 ? ? -55.08 172.00 83 20 HIS A 826 ? ? -94.88 -64.04 84 20 GLU A 827 ? ? -36.37 -39.06 85 20 HIS A 830 ? ? -83.42 39.74 86 20 VAL A 833 ? ? -37.11 115.04 87 20 SER A 837 ? ? 34.32 46.51 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EPV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EPV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.82mM 13C-15N PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ;0.05mM ZnCl2, 1mM IDA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EPV _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLU N N N N 72 GLU CA C N S 73 GLU C C N N 74 GLU O O N N 75 GLU CB C N N 76 GLU CG C N N 77 GLU CD C N N 78 GLU OE1 O N N 79 GLU OE2 O N N 80 GLU OXT O N N 81 GLU H H N N 82 GLU H2 H N N 83 GLU HA H N N 84 GLU HB2 H N N 85 GLU HB3 H N N 86 GLU HG2 H N N 87 GLU HG3 H N N 88 GLU HE2 H N N 89 GLU HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 HIS N N N N 101 HIS CA C N S 102 HIS C C N N 103 HIS O O N N 104 HIS CB C N N 105 HIS CG C Y N 106 HIS ND1 N Y N 107 HIS CD2 C Y N 108 HIS CE1 C Y N 109 HIS NE2 N Y N 110 HIS OXT O N N 111 HIS H H N N 112 HIS H2 H N N 113 HIS HA H N N 114 HIS HB2 H N N 115 HIS HB3 H N N 116 HIS HD1 H N N 117 HIS HD2 H N N 118 HIS HE1 H N N 119 HIS HE2 H N N 120 HIS HXT H N N 121 ILE N N N N 122 ILE CA C N S 123 ILE C C N N 124 ILE O O N N 125 ILE CB C N S 126 ILE CG1 C N N 127 ILE CG2 C N N 128 ILE CD1 C N N 129 ILE OXT O N N 130 ILE H H N N 131 ILE H2 H N N 132 ILE HA H N N 133 ILE HB H N N 134 ILE HG12 H N N 135 ILE HG13 H N N 136 ILE HG21 H N N 137 ILE HG22 H N N 138 ILE HG23 H N N 139 ILE HD11 H N N 140 ILE HD12 H N N 141 ILE HD13 H N N 142 ILE HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 PHE N N N N 191 PHE CA C N S 192 PHE C C N N 193 PHE O O N N 194 PHE CB C N N 195 PHE CG C Y N 196 PHE CD1 C Y N 197 PHE CD2 C Y N 198 PHE CE1 C Y N 199 PHE CE2 C Y N 200 PHE CZ C Y N 201 PHE OXT O N N 202 PHE H H N N 203 PHE H2 H N N 204 PHE HA H N N 205 PHE HB2 H N N 206 PHE HB3 H N N 207 PHE HD1 H N N 208 PHE HD2 H N N 209 PHE HE1 H N N 210 PHE HE2 H N N 211 PHE HZ H N N 212 PHE HXT H N N 213 PRO N N N N 214 PRO CA C N S 215 PRO C C N N 216 PRO O O N N 217 PRO CB C N N 218 PRO CG C N N 219 PRO CD C N N 220 PRO OXT O N N 221 PRO H H N N 222 PRO HA H N N 223 PRO HB2 H N N 224 PRO HB3 H N N 225 PRO HG2 H N N 226 PRO HG3 H N N 227 PRO HD2 H N N 228 PRO HD3 H N N 229 PRO HXT H N N 230 SER N N N N 231 SER CA C N S 232 SER C C N N 233 SER O O N N 234 SER CB C N N 235 SER OG O N N 236 SER OXT O N N 237 SER H H N N 238 SER H2 H N N 239 SER HA H N N 240 SER HB2 H N N 241 SER HB3 H N N 242 SER HG H N N 243 SER HXT H N N 244 THR N N N N 245 THR CA C N S 246 THR C C N N 247 THR O O N N 248 THR CB C N R 249 THR OG1 O N N 250 THR CG2 C N N 251 THR OXT O N N 252 THR H H N N 253 THR H2 H N N 254 THR HA H N N 255 THR HB H N N 256 THR HG1 H N N 257 THR HG21 H N N 258 THR HG22 H N N 259 THR HG23 H N N 260 THR HXT H N N 261 TRP N N N N 262 TRP CA C N S 263 TRP C C N N 264 TRP O O N N 265 TRP CB C N N 266 TRP CG C Y N 267 TRP CD1 C Y N 268 TRP CD2 C Y N 269 TRP NE1 N Y N 270 TRP CE2 C Y N 271 TRP CE3 C Y N 272 TRP CZ2 C Y N 273 TRP CZ3 C Y N 274 TRP CH2 C Y N 275 TRP OXT O N N 276 TRP H H N N 277 TRP H2 H N N 278 TRP HA H N N 279 TRP HB2 H N N 280 TRP HB3 H N N 281 TRP HD1 H N N 282 TRP HE1 H N N 283 TRP HE3 H N N 284 TRP HZ2 H N N 285 TRP HZ3 H N N 286 TRP HH2 H N N 287 TRP HXT H N N 288 TYR N N N N 289 TYR CA C N S 290 TYR C C N N 291 TYR O O N N 292 TYR CB C N N 293 TYR CG C Y N 294 TYR CD1 C Y N 295 TYR CD2 C Y N 296 TYR CE1 C Y N 297 TYR CE2 C Y N 298 TYR CZ C Y N 299 TYR OH O N N 300 TYR OXT O N N 301 TYR H H N N 302 TYR H2 H N N 303 TYR HA H N N 304 TYR HB2 H N N 305 TYR HB3 H N N 306 TYR HD1 H N N 307 TYR HD2 H N N 308 TYR HE1 H N N 309 TYR HE2 H N N 310 TYR HH H N N 311 TYR HXT H N N 312 VAL N N N N 313 VAL CA C N S 314 VAL C C N N 315 VAL O O N N 316 VAL CB C N N 317 VAL CG1 C N N 318 VAL CG2 C N N 319 VAL OXT O N N 320 VAL H H N N 321 VAL H2 H N N 322 VAL HA H N N 323 VAL HB H N N 324 VAL HG11 H N N 325 VAL HG12 H N N 326 VAL HG13 H N N 327 VAL HG21 H N N 328 VAL HG22 H N N 329 VAL HG23 H N N 330 VAL HXT H N N 331 ZN ZN ZN N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLU N CA sing N N 68 GLU N H sing N N 69 GLU N H2 sing N N 70 GLU CA C sing N N 71 GLU CA CB sing N N 72 GLU CA HA sing N N 73 GLU C O doub N N 74 GLU C OXT sing N N 75 GLU CB CG sing N N 76 GLU CB HB2 sing N N 77 GLU CB HB3 sing N N 78 GLU CG CD sing N N 79 GLU CG HG2 sing N N 80 GLU CG HG3 sing N N 81 GLU CD OE1 doub N N 82 GLU CD OE2 sing N N 83 GLU OE2 HE2 sing N N 84 GLU OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 HIS N CA sing N N 95 HIS N H sing N N 96 HIS N H2 sing N N 97 HIS CA C sing N N 98 HIS CA CB sing N N 99 HIS CA HA sing N N 100 HIS C O doub N N 101 HIS C OXT sing N N 102 HIS CB CG sing N N 103 HIS CB HB2 sing N N 104 HIS CB HB3 sing N N 105 HIS CG ND1 sing Y N 106 HIS CG CD2 doub Y N 107 HIS ND1 CE1 doub Y N 108 HIS ND1 HD1 sing N N 109 HIS CD2 NE2 sing Y N 110 HIS CD2 HD2 sing N N 111 HIS CE1 NE2 sing Y N 112 HIS CE1 HE1 sing N N 113 HIS NE2 HE2 sing N N 114 HIS OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TRP N CA sing N N 251 TRP N H sing N N 252 TRP N H2 sing N N 253 TRP CA C sing N N 254 TRP CA CB sing N N 255 TRP CA HA sing N N 256 TRP C O doub N N 257 TRP C OXT sing N N 258 TRP CB CG sing N N 259 TRP CB HB2 sing N N 260 TRP CB HB3 sing N N 261 TRP CG CD1 doub Y N 262 TRP CG CD2 sing Y N 263 TRP CD1 NE1 sing Y N 264 TRP CD1 HD1 sing N N 265 TRP CD2 CE2 doub Y N 266 TRP CD2 CE3 sing Y N 267 TRP NE1 CE2 sing Y N 268 TRP NE1 HE1 sing N N 269 TRP CE2 CZ2 sing Y N 270 TRP CE3 CZ3 doub Y N 271 TRP CE3 HE3 sing N N 272 TRP CZ2 CH2 doub Y N 273 TRP CZ2 HZ2 sing N N 274 TRP CZ3 CH2 sing Y N 275 TRP CZ3 HZ3 sing N N 276 TRP CH2 HH2 sing N N 277 TRP OXT HXT sing N N 278 TYR N CA sing N N 279 TYR N H sing N N 280 TYR N H2 sing N N 281 TYR CA C sing N N 282 TYR CA CB sing N N 283 TYR CA HA sing N N 284 TYR C O doub N N 285 TYR C OXT sing N N 286 TYR CB CG sing N N 287 TYR CB HB2 sing N N 288 TYR CB HB3 sing N N 289 TYR CG CD1 doub Y N 290 TYR CG CD2 sing Y N 291 TYR CD1 CE1 sing Y N 292 TYR CD1 HD1 sing N N 293 TYR CD2 CE2 doub Y N 294 TYR CD2 HD2 sing N N 295 TYR CE1 CZ doub Y N 296 TYR CE1 HE1 sing N N 297 TYR CE2 CZ sing Y N 298 TYR CE2 HE2 sing N N 299 TYR CZ OH sing N N 300 TYR OH HH sing N N 301 TYR OXT HXT sing N N 302 VAL N CA sing N N 303 VAL N H sing N N 304 VAL N H2 sing N N 305 VAL CA C sing N N 306 VAL CA CB sing N N 307 VAL CA HA sing N N 308 VAL C O doub N N 309 VAL C OXT sing N N 310 VAL CB CG1 sing N N 311 VAL CB CG2 sing N N 312 VAL CB HB sing N N 313 VAL CG1 HG11 sing N N 314 VAL CG1 HG12 sing N N 315 VAL CG1 HG13 sing N N 316 VAL CG2 HG21 sing N N 317 VAL CG2 HG22 sing N N 318 VAL CG2 HG23 sing N N 319 VAL OXT HXT sing N N 320 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EPV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_