data_2EQF # _entry.id 2EQF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EQF pdb_00002eqf 10.2210/pdb2eqf/pdb RCSB RCSB026980 ? ? WWPDB D_1000026980 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003100168.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2EQF _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayahsi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the 7th A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tumor necrosis factor, alpha-induced protein 3' 4814.299 1 3.-.-.- ? 'A20-type zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Putative DNA-binding protein A20, Zinc finger protein A20' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003100168.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 LYS n 1 10 GLN n 1 11 ARG n 1 12 CYS n 1 13 ARG n 1 14 ALA n 1 15 PRO n 1 16 ALA n 1 17 CYS n 1 18 ASP n 1 19 HIS n 1 20 PHE n 1 21 GLY n 1 22 ASN n 1 23 ALA n 1 24 LYS n 1 25 CYS n 1 26 ASN n 1 27 GLY n 1 28 TYR n 1 29 CYS n 1 30 ASN n 1 31 GLU n 1 32 CYS n 1 33 PHE n 1 34 GLN n 1 35 PHE n 1 36 LYS n 1 37 GLN n 1 38 MET n 1 39 TYR n 1 40 GLY n 1 41 SER n 1 42 GLY n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TNFAIP3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070115-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNAP3_HUMAN _struct_ref.pdbx_db_accession P21580 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG _struct_ref.pdbx_align_begin 758 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EQF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21580 _struct_ref_seq.db_align_beg 758 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 790 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EQF GLY A 1 ? UNP P21580 ? ? 'expression tag' 1 1 1 2EQF SER A 2 ? UNP P21580 ? ? 'expression tag' 2 2 1 2EQF SER A 3 ? UNP P21580 ? ? 'expression tag' 3 3 1 2EQF GLY A 4 ? UNP P21580 ? ? 'expression tag' 4 4 1 2EQF SER A 5 ? UNP P21580 ? ? 'expression tag' 5 5 1 2EQF SER A 6 ? UNP P21580 ? ? 'expression tag' 6 6 1 2EQF GLY A 7 ? UNP P21580 ? ? 'expression tag' 7 7 1 2EQF SER A 41 ? UNP P21580 ? ? 'expression tag' 41 8 1 2EQF GLY A 42 ? UNP P21580 ? ? 'expression tag' 42 9 1 2EQF PRO A 43 ? UNP P21580 ? ? 'expression tag' 43 10 1 2EQF SER A 44 ? UNP P21580 ? ? 'expression tag' 44 11 1 2EQF SER A 45 ? UNP P21580 ? ? 'expression tag' 45 12 1 2EQF GLY A 46 ? UNP P21580 ? ? 'expression tag' 46 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.52mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 50mM ZnCl2, 1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EQF _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2EQF _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EQF # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EQF _exptl.crystals_number ? # _struct.entry_id 2EQF _struct.title 'Solution structure of the 7th A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EQF _struct_keywords.text ;zf-A20 domain, Tumor necrosis factor, alpha-induced protein 3, Putative DNA-binding protein A20, Zinc finger protein A20, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 22 ? ASN A 26 ? ASN A 22 ASN A 26 5 ? 5 HELX_P HELX_P2 2 CYS A 29 ? GLN A 37 ? CYS A 29 GLN A 37 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 201 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 201 1_555 ? ? ? ? ? ? ? 2.263 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2EQF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 107.7 ? 2 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 114.6 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 108.3 ? 4 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 107.4 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 108.6 ? 6 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 110.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 35.72 41.63 2 1 LYS A 9 ? ? -86.41 38.06 3 1 GLN A 10 ? ? -109.88 42.95 4 1 CYS A 12 ? ? -34.64 142.66 5 1 ARG A 13 ? ? -85.81 40.17 6 1 ASP A 18 ? ? -102.91 41.66 7 1 CYS A 25 ? ? -83.75 39.15 8 1 GLN A 37 ? ? -39.59 144.67 9 1 SER A 41 ? ? -100.18 41.93 10 1 SER A 45 ? ? -170.73 143.64 11 2 SER A 2 ? ? -134.38 -57.96 12 2 GLN A 10 ? ? -160.37 106.63 13 2 ALA A 16 ? ? -118.03 69.79 14 2 HIS A 19 ? ? -48.20 157.20 15 2 CYS A 25 ? ? -95.22 35.40 16 2 PHE A 35 ? ? -37.31 -38.49 17 2 GLN A 37 ? ? -36.39 133.59 18 3 LYS A 9 ? ? -44.75 169.90 19 3 ALA A 14 ? ? -35.13 143.11 20 3 ALA A 16 ? ? -118.70 59.09 21 3 ASP A 18 ? ? -98.61 46.69 22 3 CYS A 25 ? ? -92.80 42.43 23 3 ASN A 26 ? ? 49.78 27.27 24 3 LYS A 36 ? ? -54.53 -70.88 25 4 SER A 2 ? ? -45.93 170.12 26 4 SER A 5 ? ? -54.38 179.31 27 4 ASP A 18 ? ? -106.18 41.94 28 4 CYS A 25 ? ? -86.80 41.90 29 4 TYR A 28 ? ? -54.44 171.80 30 4 MET A 38 ? ? -36.60 118.06 31 5 GLN A 10 ? ? -171.33 108.95 32 5 ALA A 16 ? ? -102.29 53.94 33 5 ALA A 23 ? ? -39.42 -37.35 34 5 CYS A 25 ? ? -103.57 48.57 35 6 SER A 2 ? ? -127.53 -54.55 36 6 SER A 3 ? ? -51.10 170.38 37 6 GLN A 10 ? ? -49.93 109.83 38 6 ALA A 14 ? ? -38.95 140.57 39 6 ALA A 16 ? ? -111.30 60.57 40 6 HIS A 19 ? ? -47.61 161.83 41 6 CYS A 25 ? ? -91.19 39.98 42 6 GLN A 37 ? ? -46.43 153.66 43 7 SER A 5 ? ? -125.71 -55.94 44 7 ALA A 16 ? ? -105.53 51.02 45 7 ASP A 18 ? ? -101.99 42.25 46 7 CYS A 25 ? ? -84.24 41.54 47 7 GLN A 37 ? ? -44.13 152.43 48 7 TYR A 39 ? ? -123.70 -56.93 49 7 SER A 44 ? ? -40.08 153.14 50 8 PRO A 8 ? ? -69.82 91.43 51 8 ARG A 11 ? ? -43.94 163.46 52 8 ALA A 16 ? ? -100.62 45.34 53 8 HIS A 19 ? ? -40.30 161.75 54 8 SER A 45 ? ? -34.66 116.20 55 9 LYS A 9 ? ? -43.16 94.55 56 9 GLN A 10 ? ? -89.44 42.96 57 9 ARG A 13 ? ? -83.71 40.80 58 9 CYS A 25 ? ? -84.63 42.96 59 9 MET A 38 ? ? -99.60 39.68 60 10 SER A 6 ? ? -131.46 -45.66 61 10 LYS A 9 ? ? -52.06 176.82 62 10 GLN A 10 ? ? -81.28 47.94 63 10 ALA A 16 ? ? -108.82 59.37 64 10 ASP A 18 ? ? -102.32 43.31 65 10 CYS A 25 ? ? -89.53 41.15 66 11 SER A 3 ? ? -131.76 -56.50 67 11 ARG A 11 ? ? -34.44 145.41 68 11 CYS A 12 ? ? -38.74 129.49 69 11 CYS A 17 ? ? -35.83 120.18 70 11 HIS A 19 ? ? -47.73 164.23 71 11 CYS A 25 ? ? -91.87 43.86 72 11 GLU A 31 ? ? -62.03 -70.47 73 11 SER A 45 ? ? -91.99 40.29 74 12 PRO A 8 ? ? -69.75 85.92 75 12 ALA A 16 ? ? -113.77 55.23 76 12 ASP A 18 ? ? -91.41 43.89 77 12 CYS A 25 ? ? -112.44 69.53 78 12 ASN A 26 ? ? 39.27 41.13 79 12 PRO A 43 ? ? -69.75 93.21 80 13 ALA A 14 ? ? -36.47 135.86 81 13 ALA A 23 ? ? -85.48 39.43 82 13 GLN A 37 ? ? -39.11 132.93 83 14 PRO A 8 ? ? -69.80 96.40 84 14 ALA A 16 ? ? -98.17 43.65 85 14 ASP A 18 ? ? -105.16 40.42 86 14 CYS A 25 ? ? -99.03 42.40 87 14 SER A 45 ? ? -129.65 -58.49 88 15 CYS A 12 ? ? -46.92 160.63 89 15 ASP A 18 ? ? -98.97 42.51 90 15 ALA A 23 ? ? -83.24 37.59 91 15 MET A 38 ? ? 39.32 29.27 92 15 PRO A 43 ? ? -69.74 2.87 93 15 SER A 44 ? ? -34.61 127.30 94 16 LYS A 9 ? ? -80.58 42.83 95 16 GLN A 10 ? ? -89.19 47.18 96 16 ASP A 18 ? ? -91.11 44.30 97 16 CYS A 25 ? ? -85.06 36.40 98 16 LYS A 36 ? ? -89.79 36.13 99 16 PRO A 43 ? ? -69.72 93.44 100 17 PRO A 8 ? ? -69.76 2.84 101 17 LYS A 9 ? ? -34.48 127.27 102 17 GLN A 10 ? ? -95.97 47.15 103 17 ALA A 16 ? ? -117.35 51.19 104 17 ASP A 18 ? ? -93.70 44.47 105 17 CYS A 25 ? ? -87.77 36.51 106 17 SER A 45 ? ? -99.43 42.16 107 18 SER A 2 ? ? -48.41 152.89 108 18 ALA A 14 ? ? -39.03 135.77 109 18 CYS A 25 ? ? -93.33 41.87 110 18 GLN A 37 ? ? -48.40 155.17 111 18 MET A 38 ? ? -69.61 90.54 112 18 TYR A 39 ? ? 34.52 44.85 113 18 SER A 44 ? ? -34.46 98.67 114 19 SER A 2 ? ? -96.65 41.78 115 19 SER A 5 ? ? -35.64 127.23 116 19 SER A 6 ? ? -174.96 111.03 117 19 GLN A 10 ? ? -97.99 45.33 118 19 ALA A 16 ? ? -105.25 48.42 119 19 ASP A 18 ? ? -95.81 43.74 120 19 CYS A 25 ? ? -113.93 68.59 121 19 ASN A 26 ? ? 36.42 29.76 122 19 GLN A 37 ? ? -40.07 155.58 123 19 SER A 41 ? ? -105.11 77.58 124 20 PRO A 8 ? ? -69.66 0.27 125 20 LYS A 9 ? ? -85.92 42.84 126 20 GLN A 10 ? ? -94.16 43.06 127 20 CYS A 12 ? ? -44.19 150.77 128 20 CYS A 25 ? ? -96.86 42.67 129 20 SER A 45 ? ? -172.26 145.17 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #