data_2EQG # _entry.id 2EQG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EQG pdb_00002eqg 10.2210/pdb2eqg/pdb RCSB RCSB026981 ? ? WWPDB D_1000026981 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003100168.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2EQG _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayahsi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tumor necrosis factor, alpha-induced protein 3' 5212.726 1 3.-.-.- ? 'A20-type zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Putative DNA-binding protein A20, Zinc finger protein A20' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003100168.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 LEU n 1 10 MET n 1 11 ASP n 1 12 VAL n 1 13 LYS n 1 14 CYS n 1 15 GLU n 1 16 THR n 1 17 PRO n 1 18 ASN n 1 19 CYS n 1 20 PRO n 1 21 PHE n 1 22 PHE n 1 23 MET n 1 24 SER n 1 25 VAL n 1 26 ASN n 1 27 THR n 1 28 GLN n 1 29 PRO n 1 30 LEU n 1 31 CYS n 1 32 HIS n 1 33 GLU n 1 34 CYS n 1 35 SER n 1 36 GLU n 1 37 ARG n 1 38 ARG n 1 39 GLN n 1 40 LYS n 1 41 ASN n 1 42 GLN n 1 43 ASN n 1 44 SER n 1 45 GLY n 1 46 PRO n 1 47 SER n 1 48 SER n 1 49 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TNFAIP3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070115-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNAP3_HUMAN _struct_ref.pdbx_db_accession P21580 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQN _struct_ref.pdbx_align_begin 381 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EQG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21580 _struct_ref_seq.db_align_beg 381 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 416 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EQG GLY A 1 ? UNP P21580 ? ? 'expression tag' 1 1 1 2EQG SER A 2 ? UNP P21580 ? ? 'expression tag' 2 2 1 2EQG SER A 3 ? UNP P21580 ? ? 'expression tag' 3 3 1 2EQG GLY A 4 ? UNP P21580 ? ? 'expression tag' 4 4 1 2EQG SER A 5 ? UNP P21580 ? ? 'expression tag' 5 5 1 2EQG SER A 6 ? UNP P21580 ? ? 'expression tag' 6 6 1 2EQG GLY A 7 ? UNP P21580 ? ? 'expression tag' 7 7 1 2EQG SER A 44 ? UNP P21580 ? ? 'expression tag' 44 8 1 2EQG GLY A 45 ? UNP P21580 ? ? 'expression tag' 45 9 1 2EQG PRO A 46 ? UNP P21580 ? ? 'expression tag' 46 10 1 2EQG SER A 47 ? UNP P21580 ? ? 'expression tag' 47 11 1 2EQG SER A 48 ? UNP P21580 ? ? 'expression tag' 48 12 1 2EQG GLY A 49 ? UNP P21580 ? ? 'expression tag' 49 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.08mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EQG _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2EQG _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EQG # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EQG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EQG _struct.title 'Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EQG _struct_keywords.text ;zf-A20 domain, Tumor necrosis factor, alpha-induced protein 3, Putative DNA-binding protein A20, Zinc finger protein A20, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 40 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 40 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc2 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.254 ? ? metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 201 1_555 ? ? ? ? ? ? ? 2.277 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 1 -0.02 2 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 2 0.01 3 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 3 -0.01 4 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 4 -0.08 5 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 5 0.00 6 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 6 0.03 7 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 7 0.02 8 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 8 0.04 9 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 9 0.12 10 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 10 -0.04 11 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 11 -0.04 12 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 12 -0.05 13 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 13 -0.01 14 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 14 -0.05 15 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 15 0.05 16 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 16 0.04 17 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 17 -0.03 18 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 18 0.03 19 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 19 -0.06 20 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 20 -0.02 # _atom_sites.entry_id 2EQG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 19 ? A CYS 19 ? 1_555 110.4 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 112.8 ? 3 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 105.1 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 105.5 ? 5 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 107.1 ? 6 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 115.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 LEU A 9 ? ? -54.78 107.24 2 2 PRO A 17 ? ? -69.75 0.21 3 3 PRO A 17 ? ? -69.78 3.15 4 4 PRO A 17 ? ? -69.83 0.75 5 5 PRO A 46 ? ? -69.76 86.70 6 6 PRO A 17 ? ? -69.77 0.22 7 7 LEU A 9 ? ? -56.07 105.00 8 7 PRO A 17 ? ? -69.73 0.41 9 7 SER A 35 ? ? -39.48 -37.09 10 7 PRO A 46 ? ? -69.77 99.52 11 8 PRO A 17 ? ? -69.79 1.35 12 8 PRO A 20 ? ? -69.66 0.85 13 9 SER A 3 ? ? -58.26 175.46 14 9 PRO A 46 ? ? -69.78 88.51 15 10 LEU A 9 ? ? -58.24 109.78 16 10 PRO A 20 ? ? -69.78 2.96 17 10 PRO A 46 ? ? -69.74 98.99 18 11 LEU A 9 ? ? -54.83 104.96 19 11 PRO A 17 ? ? -69.79 0.19 20 12 LEU A 9 ? ? -55.98 107.99 21 13 GLU A 33 ? ? -39.12 -31.89 22 13 SER A 35 ? ? -35.10 -33.55 23 14 SER A 35 ? ? -32.05 -37.43 24 14 PRO A 46 ? ? -69.76 3.10 25 15 PRO A 17 ? ? -69.83 0.89 26 16 LEU A 9 ? ? -57.13 104.31 27 16 PRO A 17 ? ? -69.75 1.32 28 16 PRO A 46 ? ? -69.76 2.56 29 17 LYS A 40 ? ? -37.51 -32.37 30 17 PRO A 46 ? ? -69.74 84.33 31 18 PRO A 46 ? ? -69.80 96.13 32 20 PRO A 17 ? ? -69.76 1.24 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #