data_2EQP # _entry.id 2EQP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EQP pdb_00002eqp 10.2210/pdb2eqp/pdb RCSB RCSB026989 ? ? WWPDB D_1000026989 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsg002001058.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2EQP _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dang, W.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the stn_TNFRSF12A_TNFR domain of Tumor necrosis factor receptor superfamily member 12A precursor' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dang, W.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tumor necrosis factor receptor superfamily member 12A' _entity.formula_weight 4958.428 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'stn_TNFRSF12A_TNFR domain, UNP residues 28-70' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Fibroblast growth factor-inducible immediate-early response protein 14, FGF-inducible 14, Tweak-receptor, TweakR, CD266 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsg002001058.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 GLN n 1 10 ALA n 1 11 PRO n 1 12 GLY n 1 13 THR n 1 14 ALA n 1 15 PRO n 1 16 CYS n 1 17 SER n 1 18 ARG n 1 19 GLY n 1 20 SER n 1 21 SER n 1 22 TRP n 1 23 SER n 1 24 ALA n 1 25 ASP n 1 26 LEU n 1 27 ASP n 1 28 LYS n 1 29 CYS n 1 30 MET n 1 31 ASP n 1 32 CYS n 1 33 ALA n 1 34 SER n 1 35 CYS n 1 36 ARG n 1 37 ALA n 1 38 ARG n 1 39 PRO n 1 40 HIS n 1 41 SER n 1 42 ASP n 1 43 PHE n 1 44 CYS n 1 45 LEU n 1 46 GLY n 1 47 CYS n 1 48 ALA n 1 49 ALA n 1 50 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TNFRSF12A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060919-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNR12_HUMAN _struct_ref.pdbx_db_accession Q9NP84 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EQP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NP84 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EQP GLY A 1 ? UNP Q9NP84 ? ? 'expression tag' 1 1 1 2EQP SER A 2 ? UNP Q9NP84 ? ? 'expression tag' 2 2 1 2EQP SER A 3 ? UNP Q9NP84 ? ? 'expression tag' 3 3 1 2EQP GLY A 4 ? UNP Q9NP84 ? ? 'expression tag' 4 4 1 2EQP SER A 5 ? UNP Q9NP84 ? ? 'expression tag' 5 5 1 2EQP SER A 6 ? UNP Q9NP84 ? ? 'expression tag' 6 6 1 2EQP GLY A 7 ? UNP Q9NP84 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EQP _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2EQP _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EQP # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EQP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EQP _struct.title 'Solution structure of the stn_TNFRSF12A_TNFR domain of Tumor necrosis factor receptor superfamily member 12A precursor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EQP _struct_keywords.text ;stn_TNFRSF12A_TNFR domain, Tumor necrosis factor receptor superfamily member 12A precursor, Fibroblast growth factor-inducible immediate-early response protein 14, FGF-inducible 14, Tweak-receptor, TweakR, CD266 antigen, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 2 CYS A 32 ? ALA A 37 ? CYS A 32 ALA A 37 1 ? 6 HELX_P HELX_P2 3 ASP A 42 ? LEU A 45 ? ASP A 42 LEU A 45 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 21 ? SER A 23 ? SER A 21 SER A 23 A 2 LYS A 28 ? MET A 30 ? LYS A 28 MET A 30 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 21 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _atom_sites.entry_id 2EQP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? 34.87 47.02 2 1 PRO A 11 ? ? -69.79 2.91 3 1 PRO A 15 ? ? -69.69 -165.67 4 1 HIS A 40 ? ? -88.32 33.29 5 2 SER A 2 ? ? -122.26 -55.18 6 2 SER A 5 ? ? 38.40 42.16 7 2 PRO A 11 ? ? -69.79 2.35 8 2 THR A 13 ? ? -132.35 -40.17 9 2 CYS A 16 ? ? -34.53 148.86 10 2 SER A 17 ? ? -121.38 -64.35 11 2 HIS A 40 ? ? -86.67 40.15 12 3 PRO A 11 ? ? -69.80 3.07 13 3 PRO A 15 ? ? -69.80 -164.55 14 3 CYS A 16 ? ? -86.18 48.72 15 3 SER A 17 ? ? -55.36 84.71 16 3 ARG A 18 ? ? 34.59 49.91 17 3 ASP A 27 ? ? 72.36 38.16 18 3 HIS A 40 ? ? -82.06 42.62 19 4 ALA A 10 ? ? -170.72 145.12 20 4 PRO A 15 ? ? -69.74 -174.01 21 4 ARG A 18 ? ? -173.40 147.12 22 4 ASP A 27 ? ? 71.40 38.10 23 4 HIS A 40 ? ? -84.38 37.08 24 4 ALA A 48 ? ? -64.88 90.08 25 5 SER A 6 ? ? 36.15 41.93 26 5 ALA A 10 ? ? -44.89 157.57 27 5 PRO A 15 ? ? -69.69 -173.26 28 5 CYS A 16 ? ? -81.94 43.58 29 5 HIS A 40 ? ? -87.51 34.91 30 6 SER A 2 ? ? -64.94 98.88 31 6 GLU A 8 ? ? 38.09 41.99 32 6 PRO A 15 ? ? -69.75 -179.41 33 6 HIS A 40 ? ? -83.34 39.87 34 6 CYS A 47 ? ? -86.24 37.97 35 7 PRO A 15 ? ? -69.79 -170.45 36 7 SER A 17 ? ? -105.83 -66.34 37 7 HIS A 40 ? ? -84.29 35.67 38 8 SER A 5 ? ? -120.06 -53.41 39 8 PRO A 11 ? ? -69.79 97.90 40 8 HIS A 40 ? ? -88.99 38.19 41 9 SER A 3 ? ? -160.50 106.84 42 9 PRO A 11 ? ? -69.79 -169.56 43 9 PRO A 15 ? ? -69.78 -172.11 44 10 ALA A 10 ? ? -36.87 144.44 45 10 PRO A 15 ? ? -69.72 -176.63 46 10 CYS A 16 ? ? -34.36 115.28 47 10 ARG A 18 ? ? -35.26 122.49 48 10 HIS A 40 ? ? -87.20 31.09 49 11 GLN A 9 ? ? 35.04 41.26 50 11 PRO A 15 ? ? -69.73 -174.42 51 11 HIS A 40 ? ? -85.08 32.82 52 12 PRO A 15 ? ? -69.78 -168.92 53 12 HIS A 40 ? ? -82.16 42.31 54 13 PRO A 15 ? ? -69.69 -178.24 55 13 HIS A 40 ? ? -84.95 36.08 56 14 SER A 2 ? ? -63.04 91.90 57 14 SER A 3 ? ? -40.64 107.15 58 14 PRO A 15 ? ? -69.79 -177.26 59 14 HIS A 40 ? ? -83.96 35.81 60 15 GLU A 8 ? ? -64.40 98.12 61 15 PRO A 15 ? ? -69.85 -175.52 62 15 CYS A 16 ? ? -79.56 44.86 63 15 HIS A 40 ? ? -83.47 36.47 64 16 SER A 2 ? ? 71.71 42.05 65 16 SER A 5 ? ? 37.63 41.96 66 16 GLN A 9 ? ? -47.43 153.47 67 16 CYS A 16 ? ? -80.76 43.24 68 16 HIS A 40 ? ? -86.99 35.86 69 17 SER A 2 ? ? -51.58 174.76 70 17 PRO A 15 ? ? -69.81 -175.63 71 17 ARG A 18 ? ? -45.94 108.72 72 17 HIS A 40 ? ? -85.49 37.71 73 17 CYS A 47 ? ? -81.02 43.13 74 17 ALA A 48 ? ? -92.83 -62.38 75 18 PRO A 15 ? ? -69.80 -174.82 76 18 ARG A 18 ? ? -37.71 147.24 77 18 HIS A 40 ? ? -88.90 41.30 78 18 ALA A 48 ? ? -55.15 106.14 79 19 GLN A 9 ? ? -67.23 87.44 80 19 PRO A 15 ? ? -69.71 -178.06 81 19 HIS A 40 ? ? -88.11 41.45 82 19 ALA A 48 ? ? -37.91 107.06 83 20 PRO A 15 ? ? -69.75 -178.85 84 20 CYS A 16 ? ? -80.11 43.82 85 20 ASP A 27 ? ? 71.18 38.82 86 20 ALA A 33 ? ? -39.57 -25.87 87 20 HIS A 40 ? ? -86.91 35.95 #