data_2EQZ # _entry.id 2EQZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EQZ pdb_00002eqz 10.2210/pdb2eqz/pdb RCSB RCSB026999 ? ? WWPDB D_1000026999 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2EQZ _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002002696.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Kurosaki, C.' 2 'Yoshida, M.' 3 'Hayahsi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the first HMG-box domain from high mobility group protein B3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Kurosaki, C.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'High mobility group protein B3' _entity.formula_weight 9816.260 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG-box domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'High mobility group protein 4, HMG-4, High mobility group protein 2a, HMG-2a' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDR EMKDYG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDR EMKDYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002002696.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ALA n 1 10 LYS n 1 11 GLY n 1 12 ASP n 1 13 PRO n 1 14 LYS n 1 15 LYS n 1 16 PRO n 1 17 LYS n 1 18 GLY n 1 19 LYS n 1 20 MET n 1 21 SER n 1 22 ALA n 1 23 TYR n 1 24 ALA n 1 25 PHE n 1 26 PHE n 1 27 VAL n 1 28 GLN n 1 29 THR n 1 30 CYS n 1 31 ARG n 1 32 GLU n 1 33 GLU n 1 34 HIS n 1 35 LYS n 1 36 LYS n 1 37 LYS n 1 38 ASN n 1 39 PRO n 1 40 GLU n 1 41 VAL n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 PHE n 1 46 ALA n 1 47 GLU n 1 48 PHE n 1 49 SER n 1 50 LYS n 1 51 LYS n 1 52 CYS n 1 53 SER n 1 54 GLU n 1 55 ARG n 1 56 TRP n 1 57 LYS n 1 58 THR n 1 59 MET n 1 60 SER n 1 61 GLY n 1 62 LYS n 1 63 GLU n 1 64 LYS n 1 65 SER n 1 66 LYS n 1 67 PHE n 1 68 ASP n 1 69 GLU n 1 70 MET n 1 71 ALA n 1 72 LYS n 1 73 ALA n 1 74 ASP n 1 75 LYS n 1 76 VAL n 1 77 ARG n 1 78 TYR n 1 79 ASP n 1 80 ARG n 1 81 GLU n 1 82 MET n 1 83 LYS n 1 84 ASP n 1 85 TYR n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HMGB3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061030-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EQZ _exptl.crystals_number ? # _struct.entry_id 2EQZ _struct.title 'Solution structure of the first HMG-box domain from high mobility group protein B3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EQZ _struct_keywords.text ;HMG-box domain, High mobility group protein B3, mobility group protein 4, mobility group protein 2a, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HMGB3_HUMAN _struct_ref.pdbx_db_accession O15347 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYG _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EQZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15347 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EQZ GLY A 1 ? UNP O15347 ? ? 'expression tag' 1 1 1 2EQZ SER A 2 ? UNP O15347 ? ? 'expression tag' 2 2 1 2EQZ SER A 3 ? UNP O15347 ? ? 'expression tag' 3 3 1 2EQZ GLY A 4 ? UNP O15347 ? ? 'expression tag' 4 4 1 2EQZ SER A 5 ? UNP O15347 ? ? 'expression tag' 5 5 1 2EQZ SER A 6 ? UNP O15347 ? ? 'expression tag' 6 6 1 2EQZ GLY A 7 ? UNP O15347 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 21 ? ASN A 38 ? SER A 21 ASN A 38 1 ? 18 HELX_P HELX_P2 2 ASN A 44 ? THR A 58 ? ASN A 44 THR A 58 1 ? 15 HELX_P HELX_P3 3 SER A 60 ? GLY A 86 ? SER A 60 GLY A 86 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 36.90 49.82 2 1 SER A 5 ? ? -170.84 115.24 3 1 PRO A 13 ? ? -69.76 0.82 4 1 ASN A 38 ? ? -110.29 67.81 5 1 ASN A 44 ? ? -63.84 87.78 6 2 SER A 3 ? ? -47.56 172.90 7 2 SER A 6 ? ? 39.80 43.61 8 2 ALA A 9 ? ? -37.18 133.70 9 2 LYS A 14 ? ? -101.02 73.37 10 2 LYS A 17 ? ? -117.82 64.48 11 2 LYS A 37 ? ? -91.16 -61.08 12 2 ASN A 38 ? ? -109.38 70.51 13 2 ASN A 44 ? ? -68.50 91.68 14 3 ASN A 38 ? ? -108.73 70.66 15 3 ASN A 44 ? ? -67.13 81.28 16 4 SER A 5 ? ? -162.08 111.87 17 4 ASN A 38 ? ? -109.24 68.87 18 4 ASN A 44 ? ? -57.04 80.73 19 4 MET A 59 ? ? -56.87 170.51 20 5 ALA A 9 ? ? -62.58 91.54 21 5 LYS A 37 ? ? -93.76 -60.56 22 5 ASN A 38 ? ? -108.16 70.41 23 5 ASN A 44 ? ? -61.48 76.91 24 6 LYS A 10 ? ? -106.73 40.19 25 6 ASN A 38 ? ? -108.07 70.53 26 6 ASN A 44 ? ? -53.73 85.42 27 7 SER A 6 ? ? -48.66 169.58 28 7 ASP A 12 ? ? -174.63 143.01 29 7 ASN A 38 ? ? -109.61 70.06 30 7 ASN A 44 ? ? -52.52 86.17 31 8 SER A 6 ? ? 49.93 29.23 32 8 MET A 8 ? ? -45.21 165.95 33 8 ALA A 9 ? ? -166.54 112.63 34 8 ASN A 38 ? ? -110.76 67.11 35 8 ASN A 44 ? ? -64.13 87.98 36 9 SER A 3 ? ? -38.57 112.59 37 9 SER A 6 ? ? -46.43 155.35 38 9 ASN A 38 ? ? -117.00 68.16 39 9 ASN A 44 ? ? -65.95 85.36 40 9 PHE A 48 ? ? -39.44 -28.53 41 10 LYS A 36 ? ? -35.20 -36.74 42 10 LYS A 37 ? ? -94.77 -60.47 43 10 ASN A 38 ? ? -108.18 73.26 44 10 PRO A 42 ? ? -69.71 -179.67 45 10 ASN A 44 ? ? -58.43 81.32 46 11 MET A 8 ? ? -39.48 110.68 47 11 ALA A 9 ? ? -167.07 110.75 48 11 LYS A 10 ? ? -37.43 151.12 49 11 ASP A 12 ? ? -45.93 150.80 50 11 LYS A 36 ? ? -39.52 -37.69 51 11 ASN A 38 ? ? -107.47 72.21 52 11 ASN A 44 ? ? -66.86 77.39 53 12 SER A 2 ? ? 35.24 42.23 54 12 LYS A 36 ? ? -37.87 -32.96 55 12 ASN A 38 ? ? -108.60 74.43 56 12 ASN A 44 ? ? -64.76 79.96 57 13 SER A 5 ? ? -41.90 151.58 58 13 LYS A 14 ? ? -107.27 47.48 59 13 ASN A 38 ? ? -110.93 68.35 60 13 ASN A 44 ? ? -69.16 87.98 61 13 MET A 59 ? ? -48.53 178.06 62 14 ASN A 38 ? ? -114.11 73.91 63 14 ASN A 44 ? ? -60.69 82.57 64 14 PHE A 48 ? ? -38.22 -35.95 65 14 CYS A 52 ? ? -90.01 -66.96 66 15 ALA A 22 ? ? -37.63 -39.16 67 15 LYS A 36 ? ? -34.84 -33.41 68 15 LYS A 37 ? ? -94.88 -61.81 69 15 ASN A 38 ? ? -107.79 76.82 70 15 ASN A 44 ? ? -60.45 76.08 71 15 ASP A 74 ? ? -36.87 -29.14 72 16 LYS A 36 ? ? -38.74 -35.89 73 16 ASN A 38 ? ? -108.97 69.15 74 16 ASN A 44 ? ? -54.36 83.67 75 16 PHE A 48 ? ? -39.16 -32.51 76 17 PRO A 13 ? ? -69.70 6.76 77 17 ASN A 38 ? ? -115.07 66.38 78 17 ASN A 44 ? ? -59.64 79.77 79 18 SER A 2 ? ? -84.71 42.30 80 18 ASN A 38 ? ? -108.68 69.62 81 18 ASN A 44 ? ? -54.50 84.67 82 19 ASN A 38 ? ? -110.23 68.05 83 19 MET A 59 ? ? -48.02 176.92 84 20 SER A 3 ? ? -49.08 164.58 85 20 PRO A 13 ? ? -69.80 -90.96 86 20 ASN A 38 ? ? -111.59 68.59 87 20 ASN A 44 ? ? -58.51 85.18 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2EQZ _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EQZ # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.10mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EQZ _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection Delta 4.3 JEOL 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LYS N N N N 158 LYS CA C N S 159 LYS C C N N 160 LYS O O N N 161 LYS CB C N N 162 LYS CG C N N 163 LYS CD C N N 164 LYS CE C N N 165 LYS NZ N N N 166 LYS OXT O N N 167 LYS H H N N 168 LYS H2 H N N 169 LYS HA H N N 170 LYS HB2 H N N 171 LYS HB3 H N N 172 LYS HG2 H N N 173 LYS HG3 H N N 174 LYS HD2 H N N 175 LYS HD3 H N N 176 LYS HE2 H N N 177 LYS HE3 H N N 178 LYS HZ1 H N N 179 LYS HZ2 H N N 180 LYS HZ3 H N N 181 LYS HXT H N N 182 MET N N N N 183 MET CA C N S 184 MET C C N N 185 MET O O N N 186 MET CB C N N 187 MET CG C N N 188 MET SD S N N 189 MET CE C N N 190 MET OXT O N N 191 MET H H N N 192 MET H2 H N N 193 MET HA H N N 194 MET HB2 H N N 195 MET HB3 H N N 196 MET HG2 H N N 197 MET HG3 H N N 198 MET HE1 H N N 199 MET HE2 H N N 200 MET HE3 H N N 201 MET HXT H N N 202 PHE N N N N 203 PHE CA C N S 204 PHE C C N N 205 PHE O O N N 206 PHE CB C N N 207 PHE CG C Y N 208 PHE CD1 C Y N 209 PHE CD2 C Y N 210 PHE CE1 C Y N 211 PHE CE2 C Y N 212 PHE CZ C Y N 213 PHE OXT O N N 214 PHE H H N N 215 PHE H2 H N N 216 PHE HA H N N 217 PHE HB2 H N N 218 PHE HB3 H N N 219 PHE HD1 H N N 220 PHE HD2 H N N 221 PHE HE1 H N N 222 PHE HE2 H N N 223 PHE HZ H N N 224 PHE HXT H N N 225 PRO N N N N 226 PRO CA C N S 227 PRO C C N N 228 PRO O O N N 229 PRO CB C N N 230 PRO CG C N N 231 PRO CD C N N 232 PRO OXT O N N 233 PRO H H N N 234 PRO HA H N N 235 PRO HB2 H N N 236 PRO HB3 H N N 237 PRO HG2 H N N 238 PRO HG3 H N N 239 PRO HD2 H N N 240 PRO HD3 H N N 241 PRO HXT H N N 242 SER N N N N 243 SER CA C N S 244 SER C C N N 245 SER O O N N 246 SER CB C N N 247 SER OG O N N 248 SER OXT O N N 249 SER H H N N 250 SER H2 H N N 251 SER HA H N N 252 SER HB2 H N N 253 SER HB3 H N N 254 SER HG H N N 255 SER HXT H N N 256 THR N N N N 257 THR CA C N S 258 THR C C N N 259 THR O O N N 260 THR CB C N R 261 THR OG1 O N N 262 THR CG2 C N N 263 THR OXT O N N 264 THR H H N N 265 THR H2 H N N 266 THR HA H N N 267 THR HB H N N 268 THR HG1 H N N 269 THR HG21 H N N 270 THR HG22 H N N 271 THR HG23 H N N 272 THR HXT H N N 273 TRP N N N N 274 TRP CA C N S 275 TRP C C N N 276 TRP O O N N 277 TRP CB C N N 278 TRP CG C Y N 279 TRP CD1 C Y N 280 TRP CD2 C Y N 281 TRP NE1 N Y N 282 TRP CE2 C Y N 283 TRP CE3 C Y N 284 TRP CZ2 C Y N 285 TRP CZ3 C Y N 286 TRP CH2 C Y N 287 TRP OXT O N N 288 TRP H H N N 289 TRP H2 H N N 290 TRP HA H N N 291 TRP HB2 H N N 292 TRP HB3 H N N 293 TRP HD1 H N N 294 TRP HE1 H N N 295 TRP HE3 H N N 296 TRP HZ2 H N N 297 TRP HZ3 H N N 298 TRP HH2 H N N 299 TRP HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TRP N CA sing N N 262 TRP N H sing N N 263 TRP N H2 sing N N 264 TRP CA C sing N N 265 TRP CA CB sing N N 266 TRP CA HA sing N N 267 TRP C O doub N N 268 TRP C OXT sing N N 269 TRP CB CG sing N N 270 TRP CB HB2 sing N N 271 TRP CB HB3 sing N N 272 TRP CG CD1 doub Y N 273 TRP CG CD2 sing Y N 274 TRP CD1 NE1 sing Y N 275 TRP CD1 HD1 sing N N 276 TRP CD2 CE2 doub Y N 277 TRP CD2 CE3 sing Y N 278 TRP NE1 CE2 sing Y N 279 TRP NE1 HE1 sing N N 280 TRP CE2 CZ2 sing Y N 281 TRP CE3 CZ3 doub Y N 282 TRP CE3 HE3 sing N N 283 TRP CZ2 CH2 doub Y N 284 TRP CZ2 HZ2 sing N N 285 TRP CZ3 CH2 sing Y N 286 TRP CZ3 HZ3 sing N N 287 TRP CH2 HH2 sing N N 288 TRP OXT HXT sing N N 289 TYR N CA sing N N 290 TYR N H sing N N 291 TYR N H2 sing N N 292 TYR CA C sing N N 293 TYR CA CB sing N N 294 TYR CA HA sing N N 295 TYR C O doub N N 296 TYR C OXT sing N N 297 TYR CB CG sing N N 298 TYR CB HB2 sing N N 299 TYR CB HB3 sing N N 300 TYR CG CD1 doub Y N 301 TYR CG CD2 sing Y N 302 TYR CD1 CE1 sing Y N 303 TYR CD1 HD1 sing N N 304 TYR CD2 CE2 doub Y N 305 TYR CD2 HD2 sing N N 306 TYR CE1 CZ doub Y N 307 TYR CE1 HE1 sing N N 308 TYR CE2 CZ sing Y N 309 TYR CE2 HE2 sing N N 310 TYR CZ OH sing N N 311 TYR OH HH sing N N 312 TYR OXT HXT sing N N 313 VAL N CA sing N N 314 VAL N H sing N N 315 VAL N H2 sing N N 316 VAL CA C sing N N 317 VAL CA CB sing N N 318 VAL CA HA sing N N 319 VAL C O doub N N 320 VAL C OXT sing N N 321 VAL CB CG1 sing N N 322 VAL CB CG2 sing N N 323 VAL CB HB sing N N 324 VAL CG1 HG11 sing N N 325 VAL CG1 HG12 sing N N 326 VAL CG1 HG13 sing N N 327 VAL CG2 HG21 sing N N 328 VAL CG2 HG22 sing N N 329 VAL CG2 HG23 sing N N 330 VAL OXT HXT sing N N 331 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EQZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_