data_2ETZ # _entry.id 2ETZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ETZ pdb_00002etz 10.2210/pdb2etz/pdb RCSB RCSB035089 ? ? WWPDB D_1000035089 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-02-07 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_dist_value' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 14 4 'Structure model' '_struct_ref_seq_dif.details' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ETZ _pdbx_database_status.recvd_initial_deposition_date 2005-10-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LUI 'NMR Structure of the Itk SH2 domain, Pro287cis, 20 low energy structures' unspecified PDB 1LUK 'NMR Structure of the Itk SH2 domain, Pro287cis, energy minimized average structure' unspecified PDB 1LUM 'NMR Structure of the Itk SH2 domain, Pro287trans, 20 low energy structures' unspecified PDB 1LUN 'NMR Structure of the Itk SH2 domain, Pro287trans, energy minimized average structure' unspecified PDB 2EU0 'The NMR ensemble structure of the Itk SH2 domain bound to a phosphopeptide' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sundd, M.' 1 'Pletneva, E.V.' 2 'Fulton, D.B.' 3 'Andreotti, A.H.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Molecular Details of Itk Activation by Prolyl Isomerization and Phospholigand Binding: The NMR Structure of the Itk SH2 Domain Bound to a Phosphopeptide. ; J.Mol.Biol. 357 550 561 2006 JMOBAK UK 0022-2836 0070 ? 16436281 10.1016/j.jmb.2005.12.073 1 'Structural characterization of a proline-driven conformational switch within the Itk SH2 domain.' Nat.Struct.Biol. 9 900 905 2002 NSBIEW US 1072-8368 2024 ? 12402030 10.1038/nsb864 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pletneva, E.V.' 1 ? primary 'Sundd, M.' 2 ? primary 'Fulton, D.B.' 3 ? primary 'Andreotti, A.H.' 4 ? 1 'Mallis, R.J.' 5 ? 1 'Brazin, K.N.' 6 ? 1 'Fulton, D.B.' 7 ? 1 'Andreotti, A.H.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase ITK/TSK' 12560.243 1 2.7.1.112 ? 'SH2 domain' ? 2 polymer syn 'Lymphocyte cytosolic protein 2 phosphopeptide fragment' 794.723 1 ? ? 'phosphopeptide fragment sequence database residues 143-148' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'T-cell-specific kinase, IL-2-inducible T-cell kinase, Kinase EMT, Kinase TLK, Itk' 2 'SH2 domain-containing leucocyte protein of 76 kDa, SLP-76 tyrosine phosphoprotein, SLP76' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;(ACE)NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYV AEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG ; ;XNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKY VFDSIPLLIQYHQYNGGGLVTRLRYPVCG ; A ? 2 'polypeptide(L)' no yes '(ACE)AD(PTR)EPP(NH2)' XADYEPPX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ASN n 1 3 ASN n 1 4 LEU n 1 5 GLU n 1 6 THR n 1 7 TYR n 1 8 GLU n 1 9 TRP n 1 10 TYR n 1 11 ASN n 1 12 LYS n 1 13 SER n 1 14 ILE n 1 15 SER n 1 16 ARG n 1 17 ASP n 1 18 LYS n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 GLY n 1 28 LYS n 1 29 GLU n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 MET n 1 34 VAL n 1 35 ARG n 1 36 ASP n 1 37 SER n 1 38 ARG n 1 39 THR n 1 40 PRO n 1 41 GLY n 1 42 THR n 1 43 TYR n 1 44 THR n 1 45 VAL n 1 46 SER n 1 47 VAL n 1 48 PHE n 1 49 THR n 1 50 LYS n 1 51 ALA n 1 52 ILE n 1 53 ILE n 1 54 SER n 1 55 GLU n 1 56 ASN n 1 57 PRO n 1 58 CYS n 1 59 ILE n 1 60 LYS n 1 61 HIS n 1 62 TYR n 1 63 HIS n 1 64 ILE n 1 65 LYS n 1 66 GLU n 1 67 THR n 1 68 ASN n 1 69 ASP n 1 70 SER n 1 71 PRO n 1 72 LYS n 1 73 ARG n 1 74 TYR n 1 75 TYR n 1 76 VAL n 1 77 ALA n 1 78 GLU n 1 79 LYS n 1 80 TYR n 1 81 VAL n 1 82 PHE n 1 83 ASP n 1 84 SER n 1 85 ILE n 1 86 PRO n 1 87 LEU n 1 88 LEU n 1 89 ILE n 1 90 GLN n 1 91 TYR n 1 92 HIS n 1 93 GLN n 1 94 TYR n 1 95 ASN n 1 96 GLY n 1 97 GLY n 1 98 GLY n 1 99 LEU n 1 100 VAL n 1 101 THR n 1 102 ARG n 1 103 LEU n 1 104 ARG n 1 105 TYR n 1 106 PRO n 1 107 VAL n 1 108 CYS n 1 109 GLY n 2 1 ACE n 2 2 ALA n 2 3 ASP n 2 4 PTR n 2 5 GLU n 2 6 PRO n 2 7 PRO n 2 8 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Itk, Emt, Tlk, Tsk' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pGEX(2T)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The sequence of the peptide is naturally found in Mus musculus (mouse).' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 3 3 ACE ACE A . n A 1 2 ASN 2 4 4 ASN ASN A . n A 1 3 ASN 3 5 5 ASN ASN A . n A 1 4 LEU 4 6 6 LEU LEU A . n A 1 5 GLU 5 7 7 GLU GLU A . n A 1 6 THR 6 8 8 THR THR A . n A 1 7 TYR 7 9 9 TYR TYR A . n A 1 8 GLU 8 10 10 GLU GLU A . n A 1 9 TRP 9 11 11 TRP TRP A . n A 1 10 TYR 10 12 12 TYR TYR A . n A 1 11 ASN 11 13 13 ASN ASN A . n A 1 12 LYS 12 14 14 LYS LYS A . n A 1 13 SER 13 15 15 SER SER A . n A 1 14 ILE 14 16 16 ILE ILE A . n A 1 15 SER 15 17 17 SER SER A . n A 1 16 ARG 16 18 18 ARG ARG A . n A 1 17 ASP 17 19 19 ASP ASP A . n A 1 18 LYS 18 20 20 LYS LYS A . n A 1 19 ALA 19 21 21 ALA ALA A . n A 1 20 GLU 20 22 22 GLU GLU A . n A 1 21 LYS 21 23 23 LYS LYS A . n A 1 22 LEU 22 24 24 LEU LEU A . n A 1 23 LEU 23 25 25 LEU LEU A . n A 1 24 LEU 24 26 26 LEU LEU A . n A 1 25 ASP 25 27 27 ASP ASP A . n A 1 26 THR 26 28 28 THR THR A . n A 1 27 GLY 27 29 29 GLY GLY A . n A 1 28 LYS 28 30 30 LYS LYS A . n A 1 29 GLU 29 31 31 GLU GLU A . n A 1 30 GLY 30 32 32 GLY GLY A . n A 1 31 ALA 31 33 33 ALA ALA A . n A 1 32 PHE 32 34 34 PHE PHE A . n A 1 33 MET 33 35 35 MET MET A . n A 1 34 VAL 34 36 36 VAL VAL A . n A 1 35 ARG 35 37 37 ARG ARG A . n A 1 36 ASP 36 38 38 ASP ASP A . n A 1 37 SER 37 39 39 SER SER A . n A 1 38 ARG 38 40 40 ARG ARG A . n A 1 39 THR 39 41 41 THR THR A . n A 1 40 PRO 40 42 42 PRO PRO A . n A 1 41 GLY 41 43 43 GLY GLY A . n A 1 42 THR 42 44 44 THR THR A . n A 1 43 TYR 43 45 45 TYR TYR A . n A 1 44 THR 44 46 46 THR THR A . n A 1 45 VAL 45 47 47 VAL VAL A . n A 1 46 SER 46 48 48 SER SER A . n A 1 47 VAL 47 49 49 VAL VAL A . n A 1 48 PHE 48 50 50 PHE PHE A . n A 1 49 THR 49 51 51 THR THR A . n A 1 50 LYS 50 52 52 LYS LYS A . n A 1 51 ALA 51 53 53 ALA ALA A . n A 1 52 ILE 52 54 54 ILE ILE A . n A 1 53 ILE 53 55 55 ILE ILE A . n A 1 54 SER 54 56 56 SER SER A . n A 1 55 GLU 55 57 57 GLU GLU A . n A 1 56 ASN 56 58 58 ASN ASN A . n A 1 57 PRO 57 59 59 PRO PRO A . n A 1 58 CYS 58 60 60 CYS CYS A . n A 1 59 ILE 59 61 61 ILE ILE A . n A 1 60 LYS 60 62 62 LYS LYS A . n A 1 61 HIS 61 63 63 HIS HIS A . n A 1 62 TYR 62 64 64 TYR TYR A . n A 1 63 HIS 63 65 65 HIS HIS A . n A 1 64 ILE 64 66 66 ILE ILE A . n A 1 65 LYS 65 67 67 LYS LYS A . n A 1 66 GLU 66 68 68 GLU GLU A . n A 1 67 THR 67 69 69 THR THR A . n A 1 68 ASN 68 70 70 ASN ASN A . n A 1 69 ASP 69 71 71 ASP ASP A . n A 1 70 SER 70 72 72 SER SER A . n A 1 71 PRO 71 73 73 PRO PRO A . n A 1 72 LYS 72 74 74 LYS LYS A . n A 1 73 ARG 73 75 75 ARG ARG A . n A 1 74 TYR 74 76 76 TYR TYR A . n A 1 75 TYR 75 77 77 TYR TYR A . n A 1 76 VAL 76 78 78 VAL VAL A . n A 1 77 ALA 77 79 79 ALA ALA A . n A 1 78 GLU 78 80 80 GLU GLU A . n A 1 79 LYS 79 81 81 LYS LYS A . n A 1 80 TYR 80 82 82 TYR TYR A . n A 1 81 VAL 81 83 83 VAL VAL A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 ASP 83 85 85 ASP ASP A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ILE 85 87 87 ILE ILE A . n A 1 86 PRO 86 88 88 PRO PRO A . n A 1 87 LEU 87 89 89 LEU LEU A . n A 1 88 LEU 88 90 90 LEU LEU A . n A 1 89 ILE 89 91 91 ILE ILE A . n A 1 90 GLN 90 92 92 GLN GLN A . n A 1 91 TYR 91 93 93 TYR TYR A . n A 1 92 HIS 92 94 94 HIS HIS A . n A 1 93 GLN 93 95 95 GLN GLN A . n A 1 94 TYR 94 96 96 TYR TYR A . n A 1 95 ASN 95 97 97 ASN ASN A . n A 1 96 GLY 96 98 98 GLY GLY A . n A 1 97 GLY 97 99 99 GLY GLY A . n A 1 98 GLY 98 100 100 GLY GLY A . n A 1 99 LEU 99 101 101 LEU LEU A . n A 1 100 VAL 100 102 102 VAL VAL A . n A 1 101 THR 101 103 103 THR THR A . n A 1 102 ARG 102 104 104 ARG ARG A . n A 1 103 LEU 103 105 105 LEU LEU A . n A 1 104 ARG 104 106 106 ARG ARG A . n A 1 105 TYR 105 107 107 TYR TYR A . n A 1 106 PRO 106 108 108 PRO PRO A . n A 1 107 VAL 107 109 109 VAL VAL A . n A 1 108 CYS 108 110 110 CYS CYS A . n A 1 109 GLY 109 111 111 GLY GLY A . n B 2 1 ACE 1 118 118 ACE ACE B . n B 2 2 ALA 2 119 119 ALA ALA B . n B 2 3 ASP 3 120 120 ASP ASP B . n B 2 4 PTR 4 121 121 PTR PTR B . n B 2 5 GLU 5 122 122 GLU GLU B . n B 2 6 PRO 6 123 123 PRO PRO B . n B 2 7 PRO 7 124 124 PRO PRO B . n B 2 8 NH2 8 125 125 NH2 NH2 B . n # _exptl.entry_id 2ETZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2ETZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2ETZ _struct.title 'The NMR minimized average structure of the Itk SH2 domain bound to a phosphopeptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2ETZ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, phosphotyrosine binding, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP ITK_MOUSE Q03526 1 ;NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYV FDSIPLLIQYHQYNGGGLVTRLRYPVC ; 238 ? 2 UNP LCP2_MOUSE Q60787 2 ADYEPP 143 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2ETZ A 2 ? 108 ? Q03526 238 ? 344 ? 4 110 2 2 2ETZ B 2 ? 7 ? Q60787 143 ? 148 ? 119 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ETZ GLY A 109 ? UNP Q03526 ? ? 'cloning artifact' 111 1 2 2ETZ PTR B 4 ? UNP Q60787 TYR 145 'modified residue' 121 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLY A 27 ? SER A 17 GLY A 29 1 ? 13 HELX_P HELX_P2 2 SER A 84 ? ASN A 95 ? SER A 86 ASN A 97 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ASN 2 N ? ? A ACE 3 A ASN 4 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B ALA 2 N ? ? B ACE 118 B ALA 119 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? B ASP 3 C ? ? ? 1_555 B PTR 4 N ? ? B ASP 120 B PTR 121 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? B PTR 4 C ? ? ? 1_555 B GLU 5 N ? ? B PTR 121 B GLU 122 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? B PRO 7 C ? ? ? 1_555 B NH2 8 N ? ? B PRO 124 B NH2 125 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR B 4 ? . . . . PTR B 121 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 ACE A 1 ? ASN A 2 ? ACE A 3 ? 1_555 ASN A 4 ? 1_555 . . ASN 17 ACE None 'Terminal acetylation' 3 ACE B 1 ? ALA B 2 ? ACE B 118 ? 1_555 ALA B 119 ? 1_555 . . ALA 1 ACE None 'Terminal acetylation' 4 NH2 B 8 ? PRO B 7 ? NH2 B 125 ? 1_555 PRO B 124 ? 1_555 . . PRO 13 NH2 None 'Terminal amidation' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 70 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 72 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 71 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 73 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.30 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 31 ? ARG A 35 ? ALA A 33 ARG A 37 A 2 TYR A 43 ? PHE A 48 ? TYR A 45 PHE A 50 A 3 LYS A 60 ? GLU A 66 ? LYS A 62 GLU A 68 A 4 TYR A 74 ? TYR A 75 ? TYR A 76 TYR A 77 A 5 VAL A 81 ? PHE A 82 ? VAL A 83 PHE A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 35 ? N ARG A 37 O THR A 44 ? O THR A 46 A 2 3 N VAL A 47 ? N VAL A 49 O LYS A 60 ? O LYS A 62 A 3 4 N LYS A 65 ? N LYS A 67 O TYR A 75 ? O TYR A 77 A 4 5 N TYR A 74 ? N TYR A 76 O PHE A 82 ? O PHE A 84 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACE 3 ? 1 'BINDING SITE FOR RESIDUE ACE A 3' AC2 Software B ACE 118 ? 3 'BINDING SITE FOR RESIDUE ACE B 118' AC3 Software B NH2 125 ? 1 'BINDING SITE FOR RESIDUE NH2 B 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ASN A 3 ? ASN A 5 . ? 1_555 ? 2 AC2 3 ASP B 3 ? ASP B 120 . ? 1_555 ? 3 AC2 3 PTR B 4 ? PTR B 121 . ? 1_555 ? 4 AC2 3 PRO B 6 ? PRO B 123 . ? 1_555 ? 5 AC3 1 PRO B 7 ? PRO B 124 . ? 1_555 ? # _pdbx_entry_details.entry_id 2ETZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD1 A TRP 11 ? ? HB3 A PRO 108 ? ? 1.30 2 1 O A TYR 76 ? ? H A PHE 84 ? ? 1.30 3 1 O A LYS 74 ? ? HH21 A ARG 75 ? ? 1.37 4 1 H A TYR 76 ? ? O A PHE 84 ? ? 1.39 5 1 H A VAL 47 ? ? O A TYR 64 ? ? 1.41 6 1 O A GLY 32 ? ? H A TYR 107 ? ? 1.44 7 1 OG1 A THR 69 ? ? H A ASN 70 ? ? 1.45 8 1 O A VAL 49 ? ? H A LYS 62 ? ? 1.46 9 1 O A LEU 101 ? ? H A ARG 104 ? ? 1.48 10 1 O A LYS 67 ? ? H A TYR 77 ? ? 1.51 11 1 O A MET 35 ? ? H A SER 48 ? ? 1.51 12 1 O A ILE 87 ? ? H A ILE 91 ? ? 1.51 13 1 OG1 A THR 69 ? ? HH22 A ARG 75 ? ? 1.51 14 1 O A PRO 73 ? ? HE A ARG 75 ? ? 1.51 15 1 H A MET 35 ? ? O A SER 48 ? ? 1.52 16 1 H A VAL 49 ? ? O A LYS 62 ? ? 1.52 17 1 H A PHE 34 ? ? O A TYR 107 ? ? 1.53 18 1 O A ALA 21 ? ? H A LEU 25 ? ? 1.53 19 1 O A LYS 20 ? ? H A LEU 24 ? ? 1.53 20 1 H A ARG 37 ? ? O A THR 46 ? ? 1.53 21 1 O A ARG 37 ? ? H A THR 46 ? ? 1.53 22 1 O A ASP 19 ? ? H A LYS 23 ? ? 1.53 23 1 O A LEU 89 ? ? H A TYR 93 ? ? 1.53 24 1 O A PRO 88 ? ? H A GLN 92 ? ? 1.54 25 1 O A GLU 22 ? ? H A LEU 26 ? ? 1.54 26 1 O A TRP 11 ? ? H A VAL 36 ? ? 1.54 27 1 H A LYS 67 ? ? O A TYR 77 ? ? 1.55 28 1 O A ARG 18 ? ? H A GLU 22 ? ? 1.55 29 1 O A SER 86 ? ? H A LEU 90 ? ? 1.55 30 1 O A VAL 47 ? ? H A TYR 64 ? ? 1.56 31 1 O A THR 69 ? ? HH12 A ARG 75 ? ? 1.56 32 1 H A ALA 33 ? ? O A PHE 50 ? ? 1.57 33 1 O A ALA 33 ? ? H A PHE 50 ? ? 1.60 34 1 OG A SER 39 ? ? O1P B PTR 121 ? ? 2.10 35 1 O A GLY 32 ? ? O A TYR 107 ? ? 2.11 36 1 O A ALA 33 ? ? N A PHE 50 ? ? 2.13 37 1 O A LYS 30 ? ? O A PHE 50 ? ? 2.16 38 1 O A LEU 24 ? ? OG1 A THR 28 ? ? 2.16 39 1 O A GLY 32 ? ? N A TYR 107 ? ? 2.19 40 1 N A TYR 76 ? ? O A PHE 84 ? ? 2.19 41 1 NE A ARG 18 ? ? O2P B PTR 121 ? ? 2.19 42 1 O A TRP 11 ? ? N A VAL 36 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? 32.05 30.66 2 1 TYR A 9 ? ? -54.15 -162.88 3 1 TRP A 11 ? ? -157.55 -8.42 4 1 SER A 15 ? ? 53.86 10.02 5 1 SER A 17 ? ? 92.89 142.08 6 1 ARG A 18 ? ? -38.31 -24.13 7 1 GLU A 31 ? ? -56.97 70.94 8 1 SER A 39 ? ? -45.65 -162.34 9 1 THR A 44 ? ? -165.27 -126.20 10 1 THR A 51 ? ? -89.16 -150.62 11 1 ILE A 54 ? ? -47.92 -88.23 12 1 SER A 56 ? ? 50.63 -76.29 13 1 GLU A 57 ? ? -35.27 -38.37 14 1 ASN A 58 ? ? 80.90 154.22 15 1 CYS A 60 ? ? -118.42 51.15 16 1 ILE A 66 ? ? -62.85 87.93 17 1 THR A 69 ? ? -124.90 -144.63 18 1 ASN A 70 ? ? -146.29 57.99 19 1 ASP A 71 ? ? -124.00 -141.51 20 1 SER A 72 ? ? -176.37 109.48 21 1 LYS A 74 ? ? 1.95 88.69 22 1 ALA A 79 ? ? -144.38 -143.32 23 1 LYS A 81 ? ? 157.67 -22.37 24 1 ASP A 85 ? ? -96.15 34.87 25 1 SER A 86 ? ? -159.52 77.45 26 1 HIS A 94 ? ? -78.24 25.14 27 1 GLN A 95 ? ? -146.02 -36.84 28 1 VAL A 102 ? ? -24.35 104.60 29 1 THR A 103 ? ? 26.89 36.08 30 1 ARG A 104 ? ? 44.68 168.03 31 1 ARG A 106 ? ? -154.27 -68.66 32 1 VAL A 109 ? ? -79.32 24.80 33 1 CYS A 110 ? ? -32.54 104.50 34 1 GLU B 122 ? ? -17.99 89.31 35 1 PRO B 123 ? ? -57.49 101.53 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 121 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_nmr_ensemble.entry_id 2ETZ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'Average structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ETZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Itk SH2 domain, 20mM phosphopeptide, 50mM KH2PO4, 75mM NaCl, 2mM DTT, 0.02% NaN3, pH 7.4' '90% H2O/10% D2O' 2 'U-15N labeled, 1mM Itk SH2 domain, 20mM phosphopeptide, 50mM KH2PO4, 75mM NaCl, 2mM DTT, 0.02% NaN3, pH 7.4' '90% H2O/10% D2O' 3 'U-15N, 13-C labeled, 1mM Itk SH2 domain, 20mM phosphopeptide, 50mM KH2PO4, 75mM NaCl, 2mM DTT, 0.02% NaN3, pH 7.4' '90%H20, 10%D2O' 4 '5mM phosphopeptide, 50mM KH2PO4, 75mM NaCl, 2mM DTT, 0.02% NaN3, pH 7.4' '90%H20, 10%D2O' 5 '1mM Itk SH2 domain, 20mM phosphopeptide, 50mM KH2PO4, 75mM NaCl, 2mM DTT, 0.02% NaN3, pH 7.4' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 125mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-separated_NOESY 2 3 1 HNHA 2 4 1 3D_13C-separated_NOESY 3 5 1 3D_13C_separated_aromatic_NOESY 3 6 1 HNCACB 3 7 1 'CBCA(CO)NH' 3 8 1 HCCH_TOCSY 3 9 1 CCONH 3 10 1 '13C edited_13C/15_N filtered NOESY' 3 11 1 '15N_edited_13C/15N_filtered NOESY' 3 12 1 '2D TOCSY' 4 13 1 'D2O exchange experiment' 5 # _pdbx_nmr_refine.entry_id 2ETZ _pdbx_nmr_refine.method 'Distance geometry simulated annealing was used for refinement' _pdbx_nmr_refine.details ;2486 Intramolecular NOE restraints, 31 intermolecular NOE restraints, 63 dihedral angles calculated using HNHA experiment and TALOS and 27 hydrogen bonds (D20 exchange based restraints) ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR ? ? 1 processing NMRPipe ? 'Delaglio et al' 2 'data analysis' NMRView 4.1.3 'Johnson and Blevins' 3 refinement CNS 1.0 'Brunger et al' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 ILE N N N N 165 ILE CA C N S 166 ILE C C N N 167 ILE O O N N 168 ILE CB C N S 169 ILE CG1 C N N 170 ILE CG2 C N N 171 ILE CD1 C N N 172 ILE OXT O N N 173 ILE H H N N 174 ILE H2 H N N 175 ILE HA H N N 176 ILE HB H N N 177 ILE HG12 H N N 178 ILE HG13 H N N 179 ILE HG21 H N N 180 ILE HG22 H N N 181 ILE HG23 H N N 182 ILE HD11 H N N 183 ILE HD12 H N N 184 ILE HD13 H N N 185 ILE HXT H N N 186 LEU N N N N 187 LEU CA C N S 188 LEU C C N N 189 LEU O O N N 190 LEU CB C N N 191 LEU CG C N N 192 LEU CD1 C N N 193 LEU CD2 C N N 194 LEU OXT O N N 195 LEU H H N N 196 LEU H2 H N N 197 LEU HA H N N 198 LEU HB2 H N N 199 LEU HB3 H N N 200 LEU HG H N N 201 LEU HD11 H N N 202 LEU HD12 H N N 203 LEU HD13 H N N 204 LEU HD21 H N N 205 LEU HD22 H N N 206 LEU HD23 H N N 207 LEU HXT H N N 208 LYS N N N N 209 LYS CA C N S 210 LYS C C N N 211 LYS O O N N 212 LYS CB C N N 213 LYS CG C N N 214 LYS CD C N N 215 LYS CE C N N 216 LYS NZ N N N 217 LYS OXT O N N 218 LYS H H N N 219 LYS H2 H N N 220 LYS HA H N N 221 LYS HB2 H N N 222 LYS HB3 H N N 223 LYS HG2 H N N 224 LYS HG3 H N N 225 LYS HD2 H N N 226 LYS HD3 H N N 227 LYS HE2 H N N 228 LYS HE3 H N N 229 LYS HZ1 H N N 230 LYS HZ2 H N N 231 LYS HZ3 H N N 232 LYS HXT H N N 233 MET N N N N 234 MET CA C N S 235 MET C C N N 236 MET O O N N 237 MET CB C N N 238 MET CG C N N 239 MET SD S N N 240 MET CE C N N 241 MET OXT O N N 242 MET H H N N 243 MET H2 H N N 244 MET HA H N N 245 MET HB2 H N N 246 MET HB3 H N N 247 MET HG2 H N N 248 MET HG3 H N N 249 MET HE1 H N N 250 MET HE2 H N N 251 MET HE3 H N N 252 MET HXT H N N 253 NH2 N N N N 254 NH2 HN1 H N N 255 NH2 HN2 H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 PTR N N N N 297 PTR CA C N S 298 PTR C C N N 299 PTR O O N N 300 PTR OXT O N N 301 PTR CB C N N 302 PTR CG C Y N 303 PTR CD1 C Y N 304 PTR CD2 C Y N 305 PTR CE1 C Y N 306 PTR CE2 C Y N 307 PTR CZ C Y N 308 PTR OH O N N 309 PTR P P N N 310 PTR O1P O N N 311 PTR O2P O N N 312 PTR O3P O N N 313 PTR H H N N 314 PTR H2 H N N 315 PTR HA H N N 316 PTR HXT H N N 317 PTR HB2 H N N 318 PTR HB3 H N N 319 PTR HD1 H N N 320 PTR HD2 H N N 321 PTR HE1 H N N 322 PTR HE2 H N N 323 PTR HO2P H N N 324 PTR HO3P H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 NH2 N HN1 sing N N 241 NH2 N HN2 sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 PTR N CA sing N N 283 PTR N H sing N N 284 PTR N H2 sing N N 285 PTR CA C sing N N 286 PTR CA CB sing N N 287 PTR CA HA sing N N 288 PTR C O doub N N 289 PTR C OXT sing N N 290 PTR OXT HXT sing N N 291 PTR CB CG sing N N 292 PTR CB HB2 sing N N 293 PTR CB HB3 sing N N 294 PTR CG CD1 doub Y N 295 PTR CG CD2 sing Y N 296 PTR CD1 CE1 sing Y N 297 PTR CD1 HD1 sing N N 298 PTR CD2 CE2 doub Y N 299 PTR CD2 HD2 sing N N 300 PTR CE1 CZ doub Y N 301 PTR CE1 HE1 sing N N 302 PTR CE2 CZ sing Y N 303 PTR CE2 HE2 sing N N 304 PTR CZ OH sing N N 305 PTR OH P sing N N 306 PTR P O1P doub N N 307 PTR P O2P sing N N 308 PTR P O3P sing N N 309 PTR O2P HO2P sing N N 310 PTR O3P HO3P sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2ETZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ #