data_2EZX # _entry.id 2EZX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EZX pdb_00002ezx 10.2210/pdb2ezx/pdb WWPDB D_1000178070 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EZX _pdbx_database_status.recvd_initial_deposition_date 1998-07-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Cai, M.' 2 'Gronenborn, A.M.' 3 # _citation.id primary _citation.title 'Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 5 _citation.page_first 903 _citation.page_last 909 _citation.year 1998 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9783751 _citation.pdbx_database_id_DOI 10.1038/2345 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cai, M.' 1 ? primary 'Huang, Y.' 2 ? primary 'Zheng, R.' 3 ? primary 'Wei, S.Q.' 4 ? primary 'Ghirlando, R.' 5 ? primary 'Lee, M.S.' 6 ? primary 'Craigie, R.' 7 ? primary 'Gronenborn, A.M.' 8 ? primary 'Clore, G.M.' 9 ? # _cell.entry_id 2EZX _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2EZX _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BARRIER-TO-AUTOINTEGRATION FACTOR' _entity.formula_weight 10073.588 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 SER n 1 5 GLN n 1 6 LYS n 1 7 HIS n 1 8 ARG n 1 9 ASP n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 GLU n 1 14 PRO n 1 15 MET n 1 16 GLY n 1 17 GLU n 1 18 LYS n 1 19 PRO n 1 20 VAL n 1 21 GLY n 1 22 SER n 1 23 LEU n 1 24 ALA n 1 25 GLY n 1 26 ILE n 1 27 GLY n 1 28 GLU n 1 29 VAL n 1 30 LEU n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 ARG n 1 38 GLY n 1 39 PHE n 1 40 ASP n 1 41 LYS n 1 42 ALA n 1 43 TYR n 1 44 VAL n 1 45 VAL n 1 46 LEU n 1 47 GLY n 1 48 GLN n 1 49 PHE n 1 50 LEU n 1 51 VAL n 1 52 LEU n 1 53 LYS n 1 54 LYS n 1 55 ASP n 1 56 GLU n 1 57 ASP n 1 58 LEU n 1 59 PHE n 1 60 ARG n 1 61 GLU n 1 62 TRP n 1 63 LEU n 1 64 LYS n 1 65 ASP n 1 66 THR n 1 67 CYS n 1 68 GLY n 1 69 ALA n 1 70 ASN n 1 71 ALA n 1 72 LYS n 1 73 GLN n 1 74 SER n 1 75 ARG n 1 76 ASP n 1 77 CYS n 1 78 PHE n 1 79 GLY n 1 80 CYS n 1 81 LEU n 1 82 ARG n 1 83 GLU n 1 84 TRP n 1 85 CYS n 1 86 ASP n 1 87 ALA n 1 88 PHE n 1 89 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAF_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O75531 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2EZX A 1 ? 89 ? O75531 1 ? 89 ? 1 89 2 1 2EZX B 1 ? 89 ? O75531 1 ? 89 ? 1 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX600 Bruker 500 2 DMX500 Bruker 600 # _pdbx_nmr_refine.entry_id 2EZX _pdbx_nmr_refine.method 'SEE REMARK 3' _pdbx_nmr_refine.details ;THE STRUCTURES WERE CALCULATED USING THE SIMULATED ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT. 229, 129 - 136 USING THE PROGRAM X-PLOR 3.1 (BRUNGER) MODIFIED TO INCORPORATE COUPLING CONSTANT (GARRETT ET AL. (1984) J.MAGN.RESON. SERIES B 104, 99 - 103), CARBON CHEMICAL SHIFT (KUSZEWSKI ET AL. (1995) J.MAGN.RESON. SERIES B 106, 92 - 96) RESTRAINTS, 1H CHEMICAL SHIFT RESTRAINTS (KUSZEWSKI ET AL. (1995) J.MAGN.RESON. SERIES B 107, 293-297; (1996) J.MAGN.RESON. SERIES B 112, 79-81), AND A CONFORMATIONAL DATABASE POTENTIAL (KUSZWESKI ET AL. (1996) PROTEIN SCI. 5, 1067-108 AND (1997) J.MAGN.RESON. 125, 171-177). THE 3D STRUCTURE OF THE 21 KDA BAF DIMER WAS SOLVED BY MULTI-DIMENSIONAL HETERONUCLEAR-EDITED AND -FILTERED NMR BASED ON 1655 EXPERIMENTAL RESTRAINTS (PER MONOMER): (A) INTRASUBUNIT: 288 SEQUENTIAL (|I-J|=1), 267 MEDIUM RANGE (1 < |I-J| >=5) AND 190 LONG RANGE (|I-J| >5) INTERRESIDUE, AND 7 INTRARESIDUE APPROXIMATE INTERPROTON DISTANCE RESTRAINTS; 64 DISTANCE RESTRAINTS FOR 32 HYDROGEN BONDS; 257 TORSION ANGLE (84 PHI, 78 PSI, 60 CHI1 29 CHI2 AND 6 CHI3) RESTRAINTS; 66 THREE-BOND HN-HA COUPLING CONSTANT RESTRAINTS; 165 (87 CALPHA AND 78 CBETA) 13C SHIFT RESTRAINTS; 44 1H METHYL PROTON CHEMICAL SHIFTS; 259 DIPOLAR COUPLINGS (76 N-H, 76 CALPHA-C', 55 N-C' AND 52 HN-C'). (B) 48 INTERSUBUNIT INTERPROTON DISTANCE RESTRAINTS. RMS DEVIATIONS. BOND LENGTHS : 0.004931 BOND ANGLES : 0.543143 IMPROPER ANGLES : 0.551732 CDIH : 0.128297 NOE : 0.022087 COUP : 0.943946 13C SHIFTS RMS CA, CB (PPM): 1.04812, 1.20411 JHNHA RMS (HZ): 0.943946 0 DIPOLAR COUPLINGS NH CACO NCO HNCO RMS DIPOLAR (HZ): 0.421677 1.31903 0.483471 1.20095 1H METHYL SHIFTS: 0.118116 THE STRUCTURE IN THIS ENTRY IS THE RESTRAINED REGULARIZED MEAN STRUCTURE AND THE LAST NUMERIC COLUMN REPRESENTS THE RMS OF THE 40 INDIVIDUAL SIMULATED ANNEALING STRUCTURES FOUND IN PDB ENTRY 2EZY ABOUT THE MEAN COORDINATE POSITIONS. THE LAST NUMERIC COLUMN IN THE INDIVIDUAL SA STRUCTURES HAS NO MEANING. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2EZX _pdbx_nmr_details.text 'THE STRUCTURE IN THIS ENTRY IS THE RESTRAINED REGULARIZED MEAN STRUCTURE.' # _pdbx_nmr_ensemble.entry_id 2EZX _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'REGULARIZED MEAN STRUCTURE' # _pdbx_nmr_representative.entry_id 2EZX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ,RICE,SIMONSON,WARREN' 1 'structure solution' 'CNS MODIFIED' MODIFIED ? 2 # _exptl.entry_id 2EZX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EZX _struct.title 'SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF, NMR, REGULARIZED MEAN STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EZX _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, INTEGRATION, AIDS, RETROVIRUSES, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 5 ? ALA A 12 ? GLN A 5 ALA A 12 1 ? 8 HELX_P HELX_P2 2 VAL A 20 ? SER A 22 ? VAL A 20 SER A 22 5 ? 3 HELX_P HELX_P3 3 GLU A 28 ? ARG A 37 ? GLU A 28 ARG A 37 1 ? 10 HELX_P HELX_P4 4 ALA A 42 ? VAL A 51 ? ALA A 42 VAL A 51 1 ? 10 HELX_P HELX_P5 5 GLU A 56 ? CYS A 67 ? GLU A 56 CYS A 67 1 ? 12 HELX_P HELX_P6 6 ALA A 71 ? ALA A 87 ? ALA A 71 ALA A 87 1 ? 17 HELX_P HELX_P7 7 GLN B 5 ? ALA B 12 ? GLN B 5 ALA B 12 1 ? 8 HELX_P HELX_P8 8 VAL B 20 ? SER B 22 ? VAL B 20 SER B 22 5 ? 3 HELX_P HELX_P9 9 GLU B 28 ? ARG B 37 ? GLU B 28 ARG B 37 1 ? 10 HELX_P HELX_P10 10 ALA B 42 ? VAL B 51 ? ALA B 42 VAL B 51 1 ? 10 HELX_P HELX_P11 11 GLU B 56 ? CYS B 67 ? GLU B 56 CYS B 67 1 ? 12 HELX_P HELX_P12 12 ALA B 71 ? ALA B 87 ? ALA B 71 ALA B 87 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2EZX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EZX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 THR 2 2 2 THR THR B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 HIS 7 7 7 HIS HIS B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 ASP 9 9 9 ASP ASP B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 MET 15 15 15 MET MET B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 GLY 21 21 21 GLY GLY B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 PHE 39 39 39 PHE PHE B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 LYS 41 41 41 LYS LYS B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 TYR 43 43 43 TYR TYR B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 ASP 55 55 55 ASP ASP B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 PHE 59 59 59 PHE PHE B . n B 1 60 ARG 60 60 60 ARG ARG B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 TRP 62 62 62 TRP TRP B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 LYS 64 64 64 LYS LYS B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 CYS 67 67 67 CYS CYS B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 ALA 69 69 69 ALA ALA B . n B 1 70 ASN 70 70 70 ASN ASN B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 LYS 72 72 72 LYS LYS B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 ARG 75 75 75 ARG ARG B . n B 1 76 ASP 76 76 76 ASP ASP B . n B 1 77 CYS 77 77 77 CYS CYS B . n B 1 78 PHE 78 78 78 PHE PHE B . n B 1 79 GLY 79 79 79 GLY GLY B . n B 1 80 CYS 80 80 80 CYS CYS B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 TRP 84 84 84 TRP TRP B . n B 1 85 CYS 85 85 85 CYS CYS B . n B 1 86 ASP 86 86 86 ASP ASP B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 PHE 88 88 88 PHE PHE B . n B 1 89 LEU 89 89 89 LEU LEU B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_keywords # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_keywords.text' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 X-PLOR 'model building' 3.1 ? 2 X-PLOR refinement 3.1 ? 3 CNS phasing . ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 14 ? ? -41.59 159.98 2 1 PHE A 39 ? ? -105.21 74.47 3 1 CYS A 67 ? ? -131.52 -30.02 4 1 PRO B 14 ? ? -41.51 159.98 5 1 PHE B 39 ? ? -105.26 74.55 6 1 CYS B 67 ? ? -131.58 -30.05 #