data_2EZZ # _entry.id 2EZZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EZZ pdb_00002ezz 10.2210/pdb2ezz/pdb WWPDB D_1000178072 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EZZ _pdbx_database_status.recvd_initial_deposition_date 1998-07-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Cai, M.' 2 'Gronenborn, A.M.' 3 # _citation.id primary _citation.title 'Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 5 _citation.page_first 903 _citation.page_last 909 _citation.year 1998 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9783751 _citation.pdbx_database_id_DOI 10.1038/2345 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cai, M.' 1 ? primary 'Huang, Y.' 2 ? primary 'Zheng, R.' 3 ? primary 'Wei, S.Q.' 4 ? primary 'Ghirlando, R.' 5 ? primary 'Lee, M.S.' 6 ? primary 'Craigie, R.' 7 ? primary 'Gronenborn, A.M.' 8 ? primary 'Clore, G.M.' 9 ? # _cell.entry_id 2EZZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2EZZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BARRIER-TO-AUTOINTEGRATION FACTOR' _entity.formula_weight 10073.588 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 SER n 1 5 GLN n 1 6 LYS n 1 7 HIS n 1 8 ARG n 1 9 ASP n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 GLU n 1 14 PRO n 1 15 MET n 1 16 GLY n 1 17 GLU n 1 18 LYS n 1 19 PRO n 1 20 VAL n 1 21 GLY n 1 22 SER n 1 23 LEU n 1 24 ALA n 1 25 GLY n 1 26 ILE n 1 27 GLY n 1 28 GLU n 1 29 VAL n 1 30 LEU n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 ARG n 1 38 GLY n 1 39 PHE n 1 40 ASP n 1 41 LYS n 1 42 ALA n 1 43 TYR n 1 44 VAL n 1 45 VAL n 1 46 LEU n 1 47 GLY n 1 48 GLN n 1 49 PHE n 1 50 LEU n 1 51 VAL n 1 52 LEU n 1 53 LYS n 1 54 LYS n 1 55 ASP n 1 56 GLU n 1 57 ASP n 1 58 LEU n 1 59 PHE n 1 60 ARG n 1 61 GLU n 1 62 TRP n 1 63 LEU n 1 64 LYS n 1 65 ASP n 1 66 THR n 1 67 CYS n 1 68 GLY n 1 69 ALA n 1 70 ASN n 1 71 ALA n 1 72 LYS n 1 73 GLN n 1 74 SER n 1 75 ARG n 1 76 ASP n 1 77 CYS n 1 78 PHE n 1 79 GLY n 1 80 CYS n 1 81 LEU n 1 82 ARG n 1 83 GLU n 1 84 TRP n 1 85 CYS n 1 86 ASP n 1 87 ALA n 1 88 PHE n 1 89 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAF_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O75531 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC LREWCDAFL ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2EZZ A 1 ? 89 ? O75531 1 ? 89 ? 1 89 2 1 2EZZ B 1 ? 89 ? O75531 1 ? 89 ? 1 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX600 Bruker 500 2 DMX500 Bruker 600 # _pdbx_nmr_refine.entry_id 2EZZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EZZ _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ,RICE,SIMONSON,WARREN' 1 'structure solution' 'CNS MODIFIED' MODIFIED ? 2 # _exptl.entry_id 2EZZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EZZ _struct.title 'SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF NMR, ENSEMBLE OF 20 SIMULATED ANNEALING STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EZZ _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, INTEGRATION, AIDS, RETROVIRUSES, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 5 ? ALA A 12 ? GLN A 5 ALA A 12 1 ? 8 HELX_P HELX_P2 2 VAL A 20 ? SER A 22 ? VAL A 20 SER A 22 5 ? 3 HELX_P HELX_P3 3 GLU A 28 ? GLU A 36 ? GLU A 28 GLU A 36 1 ? 9 HELX_P HELX_P4 4 ALA A 42 ? VAL A 51 ? ALA A 42 VAL A 51 1 ? 10 HELX_P HELX_P5 5 GLU A 56 ? CYS A 67 ? GLU A 56 CYS A 67 1 ? 12 HELX_P HELX_P6 6 ALA A 71 ? ALA A 87 ? ALA A 71 ALA A 87 1 ? 17 HELX_P HELX_P7 7 GLN B 5 ? ALA B 12 ? GLN B 5 ALA B 12 1 ? 8 HELX_P HELX_P8 8 VAL B 20 ? SER B 22 ? VAL B 20 SER B 22 5 ? 3 HELX_P HELX_P9 9 GLU B 28 ? GLU B 36 ? GLU B 28 GLU B 36 1 ? 9 HELX_P HELX_P10 10 ALA B 42 ? VAL B 51 ? ALA B 42 VAL B 51 1 ? 10 HELX_P HELX_P11 11 GLU B 56 ? CYS B 67 ? GLU B 56 CYS B 67 1 ? 12 HELX_P HELX_P12 12 ALA B 71 ? ALA B 87 ? ALA B 71 ALA B 87 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2EZZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EZZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 THR 2 2 2 THR THR B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 HIS 7 7 7 HIS HIS B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 ASP 9 9 9 ASP ASP B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 MET 15 15 15 MET MET B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 GLY 21 21 21 GLY GLY B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 PHE 39 39 39 PHE PHE B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 LYS 41 41 41 LYS LYS B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 TYR 43 43 43 TYR TYR B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 ASP 55 55 55 ASP ASP B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 PHE 59 59 59 PHE PHE B . n B 1 60 ARG 60 60 60 ARG ARG B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 TRP 62 62 62 TRP TRP B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 LYS 64 64 64 LYS LYS B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 CYS 67 67 67 CYS CYS B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 ALA 69 69 69 ALA ALA B . n B 1 70 ASN 70 70 70 ASN ASN B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 LYS 72 72 72 LYS LYS B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 ARG 75 75 75 ARG ARG B . n B 1 76 ASP 76 76 76 ASP ASP B . n B 1 77 CYS 77 77 77 CYS CYS B . n B 1 78 PHE 78 78 78 PHE PHE B . n B 1 79 GLY 79 79 79 GLY GLY B . n B 1 80 CYS 80 80 80 CYS CYS B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 TRP 84 84 84 TRP TRP B . n B 1 85 CYS 85 85 85 CYS CYS B . n B 1 86 ASP 86 86 86 ASP ASP B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 PHE 88 88 88 PHE PHE B . n B 1 89 LEU 89 89 89 LEU LEU B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_keywords # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_keywords.text' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 X-PLOR 'model building' 3.1 ? 2 X-PLOR refinement 3.1 ? 3 CNS phasing . ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A TRP 62 ? ? HG1 A THR 66 ? ? 1.49 2 5 O B TRP 62 ? ? HG1 B THR 66 ? ? 1.49 3 5 OD1 B ASP 57 ? ? HH21 B ARG 60 ? ? 1.55 4 5 OD1 A ASP 57 ? ? HH21 A ARG 60 ? ? 1.55 5 8 O A TRP 62 ? ? HG1 A THR 66 ? ? 1.45 6 8 O B TRP 62 ? ? HG1 B THR 66 ? ? 1.45 7 9 OD1 A ASP 57 ? ? HH21 A ARG 60 ? ? 1.56 8 9 OD1 B ASP 57 ? ? HH21 B ARG 60 ? ? 1.57 9 9 O B CYS 85 ? ? H B LEU 89 ? ? 1.57 10 9 O A CYS 85 ? ? H A LEU 89 ? ? 1.57 11 10 OD1 A ASP 55 ? ? H A LEU 58 ? ? 1.52 12 10 OD1 B ASP 55 ? ? H B LEU 58 ? ? 1.53 13 12 O A CYS 85 ? ? H A LEU 89 ? ? 1.57 14 12 O B CYS 85 ? ? H B LEU 89 ? ? 1.58 15 14 HG A CYS 67 ? ? H A ALA 69 ? ? 1.34 16 14 HG B CYS 67 ? ? H B ALA 69 ? ? 1.35 17 19 HZ3 A LYS 53 ? ? OD1 B ASP 40 ? ? 1.46 18 19 OD1 A ASP 40 ? ? HZ3 B LYS 53 ? ? 1.57 19 20 OD1 B ASP 57 ? ? HH21 B ARG 60 ? ? 1.59 20 20 OD1 A ASP 57 ? ? HH21 A ARG 60 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? 61.32 131.20 2 1 PRO A 14 ? ? -43.08 159.96 3 1 PHE A 39 ? ? -104.24 77.40 4 1 THR B 2 ? ? 61.33 131.14 5 1 PRO B 14 ? ? -42.99 159.96 6 1 PHE B 39 ? ? -104.04 77.31 7 2 PRO A 14 ? ? -40.45 160.01 8 2 LYS A 54 ? ? 41.65 21.13 9 2 CYS A 67 ? ? -132.37 -33.60 10 2 ALA A 69 ? ? -49.17 153.82 11 2 PRO B 14 ? ? -40.39 159.98 12 2 LYS B 54 ? ? 41.78 21.00 13 2 CYS B 67 ? ? -132.34 -33.48 14 2 ALA B 69 ? ? -49.18 153.79 15 3 PRO A 14 ? ? -40.75 160.41 16 3 PHE A 39 ? ? -104.18 73.07 17 3 LYS A 54 ? ? 40.63 20.87 18 3 CYS A 67 ? ? -134.30 -35.66 19 3 PRO B 14 ? ? -40.77 160.34 20 3 PHE B 39 ? ? -103.97 73.05 21 3 LYS B 54 ? ? 40.82 20.86 22 3 CYS B 67 ? ? -134.42 -35.46 23 4 PRO A 14 ? ? -42.77 159.05 24 4 PHE A 39 ? ? -103.03 74.55 25 4 CYS A 67 ? ? -131.62 -35.28 26 4 PRO B 14 ? ? -42.68 159.11 27 4 PHE B 39 ? ? -102.92 74.53 28 4 CYS B 67 ? ? -131.67 -34.96 29 5 PRO A 14 ? ? -42.70 160.05 30 5 PHE A 39 ? ? -104.09 74.05 31 5 LYS A 54 ? ? 41.27 19.62 32 5 CYS A 67 ? ? -133.02 -30.73 33 5 PHE A 88 ? ? -108.18 -88.01 34 5 PRO B 14 ? ? -42.68 159.96 35 5 PHE B 39 ? ? -104.08 74.12 36 5 LYS B 54 ? ? 41.39 19.52 37 5 CYS B 67 ? ? -132.99 -30.65 38 5 PHE B 88 ? ? -108.33 -88.11 39 6 PRO A 14 ? ? -42.11 153.90 40 6 PHE A 39 ? ? -104.02 72.97 41 6 LYS A 54 ? ? 43.00 21.16 42 6 CYS A 67 ? ? -132.22 -30.92 43 6 PHE A 88 ? ? -104.15 -84.95 44 6 PRO B 14 ? ? -42.03 153.79 45 6 PHE B 39 ? ? -104.06 72.97 46 6 LYS B 54 ? ? 42.95 21.21 47 6 CYS B 67 ? ? -132.35 -30.73 48 6 PHE B 88 ? ? -104.19 -84.99 49 7 PRO A 14 ? ? -40.00 159.10 50 7 PHE A 39 ? ? -103.87 72.61 51 7 CYS A 67 ? ? -130.95 -31.71 52 7 PRO B 14 ? ? -39.95 159.04 53 7 PHE B 39 ? ? -103.73 72.54 54 7 CYS B 67 ? ? -130.98 -31.72 55 8 PRO A 14 ? ? -42.08 159.71 56 8 PHE A 39 ? ? -104.17 74.87 57 8 PRO B 14 ? ? -42.13 159.70 58 8 PHE B 39 ? ? -104.25 74.94 59 8 CYS B 67 ? ? -131.27 -30.07 60 9 PRO A 14 ? ? -38.98 158.14 61 9 PHE A 39 ? ? -104.73 73.46 62 9 CYS A 67 ? ? -131.81 -31.34 63 9 PRO B 14 ? ? -39.01 158.13 64 9 PHE B 39 ? ? -104.86 73.62 65 9 LYS B 54 ? ? 59.27 19.97 66 9 CYS B 67 ? ? -131.76 -31.59 67 10 PRO A 14 ? ? -42.78 159.97 68 10 PHE A 39 ? ? -104.23 75.22 69 10 PRO B 14 ? ? -42.82 159.92 70 10 PHE B 39 ? ? -104.13 75.38 71 10 LYS B 54 ? ? 59.96 19.90 72 11 PRO A 14 ? ? -45.29 159.95 73 11 PHE A 39 ? ? -104.71 75.89 74 11 CYS A 67 ? ? -132.10 -34.92 75 11 PHE A 88 ? ? -106.45 -86.48 76 11 PRO B 14 ? ? -45.15 160.01 77 11 PHE B 39 ? ? -104.62 75.97 78 11 CYS B 67 ? ? -132.10 -34.71 79 11 PHE B 88 ? ? -106.65 -86.40 80 12 PRO A 14 ? ? -43.14 159.82 81 12 PHE A 39 ? ? -104.73 73.36 82 12 CYS A 67 ? ? -132.68 -31.21 83 12 PRO B 14 ? ? -43.21 159.80 84 12 PHE B 39 ? ? -104.74 73.53 85 12 CYS B 67 ? ? -132.49 -31.29 86 13 PRO A 14 ? ? -39.19 160.52 87 13 PHE A 39 ? ? -103.48 75.23 88 13 PRO B 14 ? ? -39.13 160.27 89 13 PHE B 39 ? ? -103.32 75.15 90 14 PRO A 14 ? ? -42.27 163.78 91 14 PHE A 39 ? ? -105.35 74.76 92 14 PRO B 14 ? ? -42.34 163.83 93 14 PHE B 39 ? ? -105.34 75.00 94 15 PRO A 14 ? ? -42.57 160.23 95 15 PHE A 39 ? ? -103.89 71.98 96 15 LYS A 54 ? ? 59.80 19.88 97 15 CYS A 67 ? ? -131.22 -34.01 98 15 PRO B 14 ? ? -42.60 160.38 99 15 PHE B 39 ? ? -103.74 71.82 100 15 CYS B 67 ? ? -131.23 -33.93 101 16 PRO A 14 ? ? -42.16 159.57 102 16 CYS A 67 ? ? -132.48 -33.27 103 16 PHE A 88 ? ? -105.58 -85.63 104 16 PRO B 14 ? ? -42.14 159.61 105 16 CYS B 67 ? ? -132.48 -33.24 106 16 PHE B 88 ? ? -105.66 -85.66 107 17 PRO A 14 ? ? -41.02 160.37 108 17 PHE A 39 ? ? -104.99 73.29 109 17 PHE A 88 ? ? -103.01 -85.04 110 17 PRO B 14 ? ? -41.17 160.33 111 17 PHE B 39 ? ? -104.82 73.09 112 17 LYS B 54 ? ? 59.99 20.00 113 17 PHE B 88 ? ? -103.12 -85.10 114 18 THR A 2 ? ? -80.00 -71.05 115 18 PRO A 14 ? ? -40.06 162.17 116 18 PHE A 39 ? ? -103.77 73.31 117 18 THR B 2 ? ? -80.02 -70.99 118 18 PRO B 14 ? ? -39.95 162.05 119 18 PHE B 39 ? ? -103.40 73.35 120 18 LYS B 54 ? ? 59.30 20.00 121 19 THR A 2 ? ? -140.07 -46.01 122 19 PRO A 14 ? ? -41.48 160.03 123 19 PHE A 39 ? ? -103.69 74.92 124 19 CYS A 67 ? ? -133.09 -34.59 125 19 PHE A 88 ? ? -102.86 -84.85 126 19 THR B 2 ? ? -140.03 -46.02 127 19 PRO B 14 ? ? -41.47 160.13 128 19 PHE B 39 ? ? -103.51 74.78 129 19 CYS B 67 ? ? -133.16 -34.46 130 19 PHE B 88 ? ? -102.84 -84.71 131 20 PRO A 14 ? ? -43.06 159.98 132 20 PHE A 39 ? ? -103.88 75.61 133 20 PRO B 14 ? ? -43.13 160.04 134 20 PHE B 39 ? ? -103.70 75.48 #