data_2F3V # _entry.id 2F3V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2F3V pdb_00002f3v 10.2210/pdb2f3v/pdb RCSB RCSB035419 ? ? WWPDB D_1000035419 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2F3W 'staphylococcal nuclease in 2M TMAO' unspecified PDB 1RKN 'staphylococcal nuclease with G88W mutation' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2F3V _pdbx_database_status.recvd_initial_deposition_date 2005-11-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, D.' 1 'Xie, T.' 2 'Feng, Y.' 3 'Shan, L.' 4 'Ye, K.' 5 'Wang, J.' 6 # _citation.id primary _citation.title 'Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease' _citation.journal_abbrev Biophys.J. _citation.journal_volume 92 _citation.page_first 2090 _citation.page_last 2107 _citation.year 2007 _citation.journal_id_ASTM BIOJAU _citation.country US _citation.journal_id_ISSN 0006-3495 _citation.journal_id_CSD 0030 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17172296 _citation.pdbx_database_id_DOI 10.1529/biophysj.106.092155 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xie, T.' 1 ? primary 'Liu, D.' 2 ? primary 'Feng, Y.' 3 ? primary 'Shan, L.' 4 ? primary 'Wang, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thermonuclease _entity.formula_weight 12412.477 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.31.1 _entity.pdbx_mutation V66W _entity.pdbx_fragment 'Residues 1-110' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Staphylococcal nuclease, TNase, Micrococcal nuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMWENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAK ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMWENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 VAL n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 THR n 1 45 LYS n 1 46 HIS n 1 47 PRO n 1 48 LYS n 1 49 LYS n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 TYR n 1 55 GLY n 1 56 PRO n 1 57 GLU n 1 58 ALA n 1 59 SER n 1 60 ALA n 1 61 PHE n 1 62 THR n 1 63 LYS n 1 64 LYS n 1 65 MET n 1 66 TRP n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LYS n 1 71 LYS n 1 72 ILE n 1 73 GLU n 1 74 VAL n 1 75 GLU n 1 76 PHE n 1 77 ASP n 1 78 LYS n 1 79 GLY n 1 80 GLN n 1 81 ARG n 1 82 THR n 1 83 ASP n 1 84 LYS n 1 85 TYR n 1 86 GLY n 1 87 ARG n 1 88 GLY n 1 89 LEU n 1 90 ALA n 1 91 TYR n 1 92 ILE n 1 93 TYR n 1 94 ALA n 1 95 ASP n 1 96 GLY n 1 97 LYS n 1 98 MET n 1 99 VAL n 1 100 ASN n 1 101 GLU n 1 102 ALA n 1 103 LEU n 1 104 VAL n 1 105 ARG n 1 106 GLN n 1 107 GLY n 1 108 LEU n 1 109 ALA n 1 110 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.pdbx_db_accession P00644 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAK ; _struct_ref.pdbx_align_begin 83 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2F3V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2F3V _struct_ref_seq_dif.mon_id TRP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 66 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00644 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 148 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 66 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 3D_15N-separated_NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM ACETATE BUFFER' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM V66W110 fragment, 50MM ACETATE BUFFER, DSS, NAN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2F3V _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2F3V _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2F3V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 ? 1 processing Felix 980 ? 2 'data analysis' Felix 980 ? 3 'structure solution' CNS 1.1 ? 4 refinement CNS 1.1 ? 5 # _exptl.entry_id 2F3V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2F3V _struct.title 'Solution structure of 1-110 fragment of staphylococcal nuclease with V66W mutation' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2F3V _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'OB-Fold, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 57 ? THR A 62 ? GLU A 57 THR A 62 1 ? 6 HELX_P HELX_P2 2 LYS A 63 ? ASN A 68 ? LYS A 63 ASN A 68 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 24 ? TYR A 27 ? LYS A 24 TYR A 27 A 2 GLN A 30 ? THR A 33 ? GLN A 30 THR A 33 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _database_PDB_matrix.entry_id 2F3V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2F3V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-05 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 70 ? ? H A GLY 96 ? ? 1.53 2 4 H A LEU 36 ? ? O A ALA 90 ? ? 1.56 3 5 O A TYR 85 ? ? H A ARG 87 ? ? 1.24 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 12 ? ? -115.56 -165.38 2 1 ASP A 19 ? ? -68.60 76.80 3 1 ASP A 21 ? ? -147.80 -48.70 4 1 THR A 22 ? ? -169.87 106.57 5 1 LYS A 49 ? ? 55.22 98.81 6 1 LYS A 53 ? ? -58.93 95.61 7 1 LYS A 63 ? ? -90.94 -68.36 8 1 LYS A 70 ? ? -51.24 100.45 9 1 GLU A 75 ? ? -125.79 -69.25 10 1 ARG A 81 ? ? 80.04 -54.76 11 1 ASN A 100 ? ? 61.32 103.83 12 1 LEU A 103 ? ? 59.69 165.32 13 1 ARG A 105 ? ? 66.77 -73.97 14 1 GLN A 106 ? ? -147.81 -47.15 15 1 ALA A 109 ? ? 60.94 85.95 16 2 ALA A 12 ? ? -115.32 -165.42 17 2 THR A 13 ? ? -120.03 -168.86 18 2 THR A 22 ? ? -54.60 109.08 19 2 LEU A 36 ? ? -44.57 151.52 20 2 GLU A 43 ? ? -73.52 -165.17 21 2 PRO A 47 ? ? -45.66 156.20 22 2 LYS A 48 ? ? -47.21 152.61 23 2 LYS A 53 ? ? -68.19 94.91 24 2 ARG A 81 ? ? -50.95 100.47 25 2 TYR A 85 ? ? -133.00 -35.04 26 2 GLU A 101 ? ? -131.36 -53.29 27 2 ARG A 105 ? ? -155.32 60.47 28 2 GLN A 106 ? ? 69.03 -67.25 29 2 LEU A 108 ? ? -118.65 60.32 30 2 ALA A 109 ? ? 62.96 144.31 31 3 ALA A 12 ? ? -127.83 -86.78 32 3 THR A 13 ? ? 167.57 119.77 33 3 ILE A 15 ? ? -125.20 -72.34 34 3 ILE A 18 ? ? -64.62 -164.23 35 3 ASP A 19 ? ? -69.14 63.40 36 3 ASP A 21 ? ? -147.09 -39.57 37 3 LYS A 45 ? ? 68.99 -67.37 38 3 LYS A 49 ? ? -155.55 29.40 39 3 LYS A 53 ? ? -67.56 94.61 40 3 LYS A 78 ? ? -78.41 -71.93 41 3 GLN A 80 ? ? -78.90 -163.35 42 3 TYR A 85 ? ? -87.69 46.48 43 3 VAL A 104 ? ? 61.47 96.25 44 3 ARG A 105 ? ? -135.74 -65.27 45 3 ALA A 109 ? ? 61.67 162.30 46 4 ALA A 12 ? ? -136.57 -80.30 47 4 THR A 13 ? ? 90.43 -69.36 48 4 LEU A 14 ? ? -51.49 87.02 49 4 THR A 22 ? ? -174.15 136.40 50 4 GLU A 43 ? ? -177.70 125.46 51 4 GLU A 57 ? ? -101.17 -78.05 52 4 ALA A 58 ? ? -104.31 -74.74 53 4 ALA A 60 ? ? -37.00 -16.20 54 4 LYS A 71 ? ? -160.35 98.86 55 4 GLU A 75 ? ? -163.55 78.66 56 4 GLN A 80 ? ? -91.32 51.00 57 4 VAL A 99 ? ? 68.61 -68.00 58 4 ALA A 102 ? ? -110.54 -167.88 59 4 LEU A 103 ? ? 63.08 144.60 60 4 VAL A 104 ? ? 63.36 81.48 61 4 ARG A 105 ? ? -172.62 -44.88 62 4 ALA A 109 ? ? -63.66 97.37 63 5 THR A 13 ? ? -176.31 24.88 64 5 ILE A 15 ? ? -127.63 -70.88 65 5 ASP A 21 ? ? -148.18 -52.16 66 5 LYS A 53 ? ? -57.82 93.08 67 5 TYR A 54 ? ? -92.97 36.06 68 5 LYS A 71 ? ? -166.25 96.63 69 5 GLU A 75 ? ? -103.56 -75.41 70 5 LYS A 78 ? ? -101.20 -61.35 71 5 TYR A 85 ? ? -133.35 -37.70 72 5 VAL A 104 ? ? 68.32 -67.66 73 5 GLN A 106 ? ? -173.56 80.88 74 6 ALA A 12 ? ? -153.65 -136.18 75 6 ASP A 21 ? ? -147.12 -49.47 76 6 LEU A 38 ? ? -59.30 96.94 77 6 GLU A 43 ? ? 177.36 -169.42 78 6 LYS A 45 ? ? 62.54 -160.10 79 6 LYS A 53 ? ? -58.62 90.89 80 6 LYS A 71 ? ? -162.06 98.11 81 6 GLN A 80 ? ? -129.00 -54.35 82 6 ALA A 90 ? ? -174.78 113.66 83 6 ALA A 109 ? ? 70.37 -64.80 84 7 ALA A 12 ? ? -166.07 104.60 85 7 THR A 13 ? ? -174.14 9.00 86 7 ILE A 15 ? ? -126.80 -68.43 87 7 ASP A 19 ? ? -67.82 -176.16 88 7 ASP A 21 ? ? -147.71 -51.98 89 7 LEU A 37 ? ? -49.06 165.23 90 7 LEU A 38 ? ? -31.99 156.68 91 7 GLU A 43 ? ? -130.51 -41.86 92 7 LYS A 45 ? ? 44.92 20.86 93 7 LYS A 49 ? ? -117.49 -81.45 94 7 LYS A 53 ? ? -60.08 91.06 95 7 LYS A 71 ? ? -166.14 100.52 96 7 LYS A 78 ? ? -61.18 -83.24 97 7 ASN A 100 ? ? -168.87 -41.44 98 7 GLU A 101 ? ? 62.25 108.17 99 7 ALA A 102 ? ? -129.12 -73.54 100 7 LEU A 103 ? ? 58.98 106.81 101 7 VAL A 104 ? ? -96.44 -66.68 102 7 ARG A 105 ? ? -175.02 -49.52 103 7 GLN A 106 ? ? -131.51 -46.02 104 7 LEU A 108 ? ? -137.95 -52.61 105 7 ALA A 109 ? ? 59.46 85.14 106 8 ALA A 12 ? ? -120.29 -90.25 107 8 THR A 13 ? ? 175.67 164.24 108 8 ILE A 15 ? ? -125.08 -77.10 109 8 ILE A 18 ? ? -51.28 -77.74 110 8 ASP A 19 ? ? -118.16 -80.97 111 8 LYS A 45 ? ? 60.17 -148.38 112 8 LYS A 49 ? ? 50.57 96.29 113 8 GLU A 75 ? ? -99.52 -118.38 114 8 GLN A 80 ? ? -91.97 -64.05 115 8 ALA A 90 ? ? -174.17 114.24 116 8 ASN A 100 ? ? 57.11 -168.17 117 8 LEU A 103 ? ? -123.82 -68.42 118 8 VAL A 104 ? ? 58.99 103.92 119 8 ARG A 105 ? ? -152.14 -43.86 120 8 GLN A 106 ? ? -168.35 35.90 121 8 ALA A 109 ? ? 66.49 98.14 122 9 ALA A 12 ? ? -115.84 -129.87 123 9 THR A 13 ? ? 175.99 -86.74 124 9 ILE A 18 ? ? -117.87 -89.43 125 9 ASP A 21 ? ? -147.19 -44.26 126 9 LEU A 36 ? ? -48.98 153.95 127 9 LYS A 45 ? ? 63.14 -80.17 128 9 LYS A 53 ? ? -59.68 95.88 129 9 ARG A 81 ? ? -162.12 94.82 130 9 LEU A 103 ? ? -149.79 -78.29 131 9 VAL A 104 ? ? 57.20 90.07 132 9 ARG A 105 ? ? -137.44 -58.53 133 10 ALA A 12 ? ? -121.34 -81.86 134 10 THR A 13 ? ? 171.36 131.25 135 10 ILE A 18 ? ? -123.82 -167.00 136 10 ASP A 21 ? ? -147.64 -46.26 137 10 THR A 22 ? ? -167.99 106.93 138 10 GLU A 43 ? ? -73.58 -82.54 139 10 LYS A 45 ? ? -177.90 -78.40 140 10 LYS A 49 ? ? -168.25 -43.50 141 10 LYS A 53 ? ? -58.91 90.77 142 10 LYS A 71 ? ? -166.22 98.33 143 10 GLU A 75 ? ? -93.51 -79.66 144 10 ASP A 95 ? ? 49.97 25.91 145 10 ASN A 100 ? ? -127.51 -72.16 146 10 GLU A 101 ? ? -176.80 -177.46 147 10 GLN A 106 ? ? -158.40 32.48 148 10 LEU A 108 ? ? -118.50 73.81 149 11 THR A 13 ? ? -64.69 80.94 150 11 ILE A 15 ? ? -125.27 -69.86 151 11 ILE A 18 ? ? -96.81 -88.92 152 11 GLU A 43 ? ? -98.27 37.87 153 11 LYS A 45 ? ? 62.04 -82.80 154 11 LYS A 49 ? ? 61.57 118.05 155 11 LYS A 53 ? ? -63.53 90.97 156 11 GLU A 75 ? ? -106.88 -66.89 157 11 ARG A 81 ? ? 54.57 95.43 158 11 ASN A 100 ? ? -47.27 164.18 159 11 ALA A 102 ? ? 62.05 115.89 160 11 LEU A 103 ? ? -132.45 -66.78 161 11 VAL A 104 ? ? -144.66 30.90 162 11 LEU A 108 ? ? 54.62 86.90 163 11 ALA A 109 ? ? 63.29 -80.81 164 12 ALA A 12 ? ? -166.42 -78.88 165 12 THR A 13 ? ? 41.88 28.74 166 12 ILE A 15 ? ? -126.29 -69.81 167 12 ASP A 21 ? ? -147.27 -49.66 168 12 THR A 22 ? ? -172.06 106.58 169 12 LYS A 28 ? ? 49.09 28.11 170 12 LYS A 45 ? ? 65.70 -78.43 171 12 LYS A 49 ? ? -170.98 44.06 172 12 LYS A 53 ? ? -58.86 90.68 173 12 LYS A 71 ? ? -164.45 98.95 174 12 LYS A 78 ? ? -94.52 -68.83 175 12 TYR A 85 ? ? -133.31 -35.33 176 12 GLN A 106 ? ? 57.91 105.73 177 12 LEU A 108 ? ? -67.71 74.90 #