data_2F52 # _entry.id 2F52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2F52 pdb_00002f52 10.2210/pdb2f52/pdb RCSB RCSB035462 ? ? WWPDB D_1000035462 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CSP 'crystal structure of the B. subtilis major cold-shock protein' unspecified PDB 1NMF 'Solution structure of Major Cold-Shock Protein' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2F52 _pdbx_database_status.recvd_initial_deposition_date 2005-11-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zeeb, M.' 1 'Sticht, H.' 2 'Balbach, J.' 3 # _citation.id primary _citation.title 'Recognition of T-rich single-stranded DNA by the cold shock protein Bs-CspB in solution.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 34 _citation.page_first 4561 _citation.page_last 4571 _citation.year 2006 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16956971 _citation.pdbx_database_id_DOI 10.1093/nar/gkl376 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zeeb, M.' 1 ? primary 'Max, K.E.' 2 ? primary 'Weininger, U.' 3 ? primary 'Low, C.' 4 ? primary 'Sticht, H.' 5 ? primary 'Balbach, J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cold shock protein cspB' _entity.formula_weight 7372.126 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Major cold shock protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA _entity_poly.pdbx_seq_one_letter_code_can MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLU n 1 4 GLY n 1 5 LYS n 1 6 VAL n 1 7 LYS n 1 8 TRP n 1 9 PHE n 1 10 ASN n 1 11 SER n 1 12 GLU n 1 13 LYS n 1 14 GLY n 1 15 PHE n 1 16 GLY n 1 17 PHE n 1 18 ILE n 1 19 GLU n 1 20 VAL n 1 21 GLU n 1 22 GLY n 1 23 GLN n 1 24 ASP n 1 25 ASP n 1 26 VAL n 1 27 PHE n 1 28 VAL n 1 29 HIS n 1 30 PHE n 1 31 SER n 1 32 ALA n 1 33 ILE n 1 34 GLN n 1 35 GLY n 1 36 GLU n 1 37 GLY n 1 38 PHE n 1 39 LYS n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 GLU n 1 44 GLY n 1 45 GLN n 1 46 ALA n 1 47 VAL n 1 48 SER n 1 49 PHE n 1 50 GLU n 1 51 ILE n 1 52 VAL n 1 53 GLU n 1 54 GLY n 1 55 ASN n 1 56 ARG n 1 57 GLY n 1 58 PRO n 1 59 GLN n 1 60 ALA n 1 61 ALA n 1 62 ASN n 1 63 VAL n 1 64 THR n 1 65 LYS n 1 66 GLU n 1 67 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene 'cspB, cspA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSPB_BACSU _struct_ref.pdbx_db_accession P32081 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2F52 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32081 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-separated_NOESY 1 3 1 3D_13C-separated_NOESY 2 4 1 HNHA 2 5 1 'RDC with IPAP' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '53mM buffer salt' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM CspB U-15N, 50mM Na-cacodylate, 3mM MgCl2, 1.2mM heptathymidine, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '0.8mM CspB U-15N, 13C, 50mM Na-cacodylate, 3mM MgCl2, 1.2mM heptathymidine, 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 900 ? 2 DMX Bruker 750 ? 3 AVANCE Bruker 600 ? 4 DRX Bruker 500 ? # _pdbx_nmr_refine.entry_id 2F52 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2F52 _pdbx_nmr_ensemble.conformers_calculated_total_number 120 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2F52 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'smalest pair-wise rmsd' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' Felix 2.3 MSI 1 'structure solution' X-PLOR 1.2.1 NIH 2 refinement X-PLOR 1.2.1 NIH 3 # _exptl.entry_id 2F52 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2F52 _struct.title 'Solution structure of cold shock protein CspB from Bacillus subtilis in complex with heptathymidine' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2F52 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN/TRANSCRIPTION' _struct_keywords.text 'beta barrel, OB-fold, DNA BINDING PROTEIN-TRANSCRIPTION COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 29 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 29 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 2 ? ASN A 10 ? LEU A 2 ASN A 10 A 2 PHE A 15 ? GLU A 19 ? PHE A 15 GLU A 19 A 3 ASP A 25 ? VAL A 28 ? ASP A 25 VAL A 28 A 4 PRO A 58 ? LYS A 65 ? PRO A 58 LYS A 65 A 5 ALA A 46 ? GLU A 53 ? ALA A 46 GLU A 53 A 6 LEU A 2 ? ASN A 10 ? LEU A 2 ASN A 10 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 7 ? N LYS A 7 O PHE A 17 ? O PHE A 17 A 2 3 N ILE A 18 ? N ILE A 18 O VAL A 26 ? O VAL A 26 A 3 4 N PHE A 27 ? N PHE A 27 O ALA A 60 ? O ALA A 60 A 4 5 O ALA A 61 ? O ALA A 61 N GLU A 50 ? N GLU A 50 A 5 6 O PHE A 49 ? O PHE A 49 N LEU A 2 ? N LEU A 2 # _database_PDB_matrix.entry_id 2F52 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2F52 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-19 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A LYS 7 ? ? O A PHE 17 ? ? 1.52 2 1 H A ASN 10 ? ? O A PHE 15 ? ? 1.55 3 2 O A VAL 6 ? ? H A GLY 44 ? ? 1.60 4 2 O A ALA 32 ? ? H A VAL 63 ? ? 1.60 5 3 OD1 A ASN 10 ? ? H A GLU 12 ? ? 1.57 6 3 O A PHE 38 ? ? HZ2 A LYS 65 ? ? 1.58 7 4 OD1 A ASN 10 ? ? H A GLU 12 ? ? 1.55 8 4 O A VAL 6 ? ? H A GLY 44 ? ? 1.55 9 5 O A VAL 6 ? ? H A GLY 44 ? ? 1.56 10 6 O A PHE 38 ? ? HZ1 A LYS 65 ? ? 1.59 11 7 O A VAL 6 ? ? H A GLY 44 ? ? 1.54 12 9 O A LYS 5 ? ? H A GLU 19 ? ? 1.59 13 9 O A ALA 32 ? ? H A VAL 63 ? ? 1.60 14 10 O A PHE 38 ? ? HZ1 A LYS 65 ? ? 1.56 15 11 O A ALA 32 ? ? H A VAL 63 ? ? 1.50 16 11 O A ILE 18 ? ? H A VAL 26 ? ? 1.50 17 11 O A HIS 29 ? ? H A ALA 32 ? ? 1.55 18 11 O A LYS 5 ? ? H A GLU 19 ? ? 1.55 19 11 O A VAL 6 ? ? H A GLY 44 ? ? 1.55 20 11 H A ILE 18 ? ? O A VAL 26 ? ? 1.56 21 12 O A ALA 32 ? ? H A VAL 63 ? ? 1.51 22 13 OD1 A ASN 10 ? ? H A GLU 12 ? ? 1.55 23 13 O A PHE 38 ? ? HZ1 A LYS 65 ? ? 1.59 24 13 O A ALA 32 ? ? H A VAL 63 ? ? 1.60 25 14 O A ALA 32 ? ? H A VAL 63 ? ? 1.57 26 15 O A ALA 32 ? ? H A VAL 63 ? ? 1.50 27 15 O A VAL 6 ? ? H A GLY 44 ? ? 1.56 28 15 O A LYS 5 ? ? H A GLU 19 ? ? 1.60 29 16 O A ALA 32 ? ? H A VAL 63 ? ? 1.52 30 16 O A LYS 5 ? ? H A GLU 19 ? ? 1.56 31 16 O A VAL 6 ? ? H A GLY 44 ? ? 1.56 32 17 O A VAL 6 ? ? H A GLY 44 ? ? 1.55 33 18 O A ALA 32 ? ? H A VAL 63 ? ? 1.51 34 18 H A LYS 7 ? ? O A PHE 17 ? ? 1.52 35 18 O A VAL 6 ? ? H A GLY 44 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 21 ? ? -59.22 108.87 2 1 ASP A 24 ? ? -52.92 -174.19 3 1 PHE A 38 ? ? 168.96 54.48 4 1 PHE A 49 ? ? 172.81 166.78 5 2 ASP A 24 ? ? -54.46 -176.44 6 2 PHE A 49 ? ? 174.63 165.82 7 3 ASP A 24 ? ? -51.13 -177.38 8 3 PHE A 49 ? ? 173.39 165.67 9 4 ASP A 24 ? ? -55.02 -176.60 10 4 PHE A 49 ? ? 175.13 165.39 11 5 ASP A 24 ? ? -55.28 -175.02 12 5 PHE A 38 ? ? -175.42 46.94 13 5 PHE A 49 ? ? 171.29 167.66 14 5 ASN A 62 ? ? 43.63 78.23 15 6 ASP A 24 ? ? -53.52 -177.12 16 6 PHE A 49 ? ? 176.28 164.70 17 6 ASN A 62 ? ? 43.19 73.91 18 7 ASP A 24 ? ? -55.31 -178.35 19 7 PHE A 38 ? ? -178.96 40.38 20 7 PHE A 49 ? ? 172.75 168.56 21 7 ASN A 62 ? ? 41.27 74.41 22 8 ASP A 24 ? ? -53.54 -177.40 23 8 LEU A 41 ? ? -59.69 174.68 24 8 PHE A 49 ? ? 175.83 164.42 25 8 ASN A 62 ? ? 38.62 73.91 26 9 ASP A 24 ? ? -54.79 -175.74 27 9 PHE A 49 ? ? 171.69 166.48 28 9 ASN A 62 ? ? 38.68 74.56 29 10 ASP A 24 ? ? -54.75 -179.21 30 10 PHE A 49 ? ? 172.26 166.14 31 10 ASN A 62 ? ? 42.82 71.90 32 11 GLU A 21 ? ? -59.08 99.93 33 11 ASP A 24 ? ? -60.24 -163.41 34 11 GLN A 34 ? ? -43.79 151.37 35 11 PHE A 49 ? ? 172.15 168.59 36 11 ASN A 62 ? ? 43.86 79.41 37 12 ASP A 24 ? ? -54.81 -171.24 38 12 PHE A 38 ? ? -152.52 38.33 39 12 PHE A 49 ? ? 172.79 166.03 40 12 ASN A 62 ? ? 37.58 66.72 41 13 ASP A 24 ? ? -55.19 -173.70 42 13 PHE A 38 ? ? -144.15 30.13 43 13 PHE A 49 ? ? 169.25 169.30 44 13 ASN A 62 ? ? 41.13 72.74 45 14 ASP A 24 ? ? -52.53 -176.83 46 14 PHE A 38 ? ? -169.57 44.85 47 14 THR A 40 ? ? -67.50 99.70 48 14 PHE A 49 ? ? 173.38 165.88 49 14 ASN A 62 ? ? 38.17 73.73 50 15 ASP A 24 ? ? -52.84 -178.96 51 15 PHE A 49 ? ? 176.09 162.47 52 15 ASN A 62 ? ? 42.20 72.59 53 16 ASP A 24 ? ? -56.93 -169.08 54 16 PHE A 49 ? ? 170.32 167.97 55 17 ASP A 24 ? ? -52.80 -169.17 56 17 PHE A 49 ? ? 173.37 163.87 57 18 ASP A 24 ? ? -50.76 -176.81 58 18 PHE A 49 ? ? 174.81 164.16 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 56 ? ? 0.251 'SIDE CHAIN' 2 2 ARG A 56 ? ? 0.318 'SIDE CHAIN' 3 3 ARG A 56 ? ? 0.169 'SIDE CHAIN' 4 4 ARG A 56 ? ? 0.195 'SIDE CHAIN' 5 5 ARG A 56 ? ? 0.309 'SIDE CHAIN' 6 6 ARG A 56 ? ? 0.242 'SIDE CHAIN' 7 7 ARG A 56 ? ? 0.315 'SIDE CHAIN' 8 8 ARG A 56 ? ? 0.266 'SIDE CHAIN' 9 9 ARG A 56 ? ? 0.271 'SIDE CHAIN' 10 10 ARG A 56 ? ? 0.287 'SIDE CHAIN' 11 11 ARG A 56 ? ? 0.225 'SIDE CHAIN' 12 12 ARG A 56 ? ? 0.309 'SIDE CHAIN' 13 13 ARG A 56 ? ? 0.317 'SIDE CHAIN' 14 14 ARG A 56 ? ? 0.163 'SIDE CHAIN' 15 15 ARG A 56 ? ? 0.201 'SIDE CHAIN' 16 16 ARG A 56 ? ? 0.288 'SIDE CHAIN' 17 17 ARG A 56 ? ? 0.234 'SIDE CHAIN' 18 18 ARG A 56 ? ? 0.232 'SIDE CHAIN' #