data_2FCD # _entry.id 2FCD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FCD pdb_00002fcd 10.2210/pdb2fcd/pdb RCSB RCSB035710 ? ? WWPDB D_1000035710 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FCD _pdbx_database_status.recvd_initial_deposition_date 2005-12-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cicero, D.O.' 1 'Pennestri, M.' 2 'Contessa, G.M.' 3 'Paci, M.' 4 'Ragnini-Wilson, A.' 5 'Melino, S.' 6 # _citation.id primary _citation.title 'Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 667 _citation.page_last 679 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17074768 _citation.pdbx_database_id_DOI 10.1074/jbc.M607016200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pennestri, M.' 1 ? primary 'Melino, S.' 2 ? primary 'Contessa, G.M.' 3 ? primary 'Casavola, E.C.' 4 ? primary 'Paci, M.' 5 ? primary 'Ragnini-Wilson, A.' 6 ? primary 'Cicero, D.O.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myosin light chain 1' _entity.formula_weight 8452.326 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myosin-2 light chain, Calmodulin-like myosin light chain MLC1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT _entity_poly.pdbx_seq_one_letter_code_can SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 THR n 1 4 ARG n 1 5 ALA n 1 6 ASN n 1 7 LYS n 1 8 ASP n 1 9 ILE n 1 10 PHE n 1 11 THR n 1 12 LEU n 1 13 PHE n 1 14 ASP n 1 15 LYS n 1 16 LYS n 1 17 GLY n 1 18 GLN n 1 19 GLY n 1 20 ALA n 1 21 ILE n 1 22 ALA n 1 23 LYS n 1 24 ASP n 1 25 SER n 1 26 LEU n 1 27 GLY n 1 28 ASP n 1 29 TYR n 1 30 LEU n 1 31 ARG n 1 32 ALA n 1 33 ILE n 1 34 GLY n 1 35 TYR n 1 36 ASN n 1 37 PRO n 1 38 THR n 1 39 ASN n 1 40 GLN n 1 41 LEU n 1 42 VAL n 1 43 GLN n 1 44 ASP n 1 45 ILE n 1 46 ILE n 1 47 ASN n 1 48 ALA n 1 49 ASP n 1 50 SER n 1 51 SER n 1 52 LEU n 1 53 ARG n 1 54 ASP n 1 55 ALA n 1 56 SER n 1 57 SER n 1 58 LEU n 1 59 THR n 1 60 LEU n 1 61 ASP n 1 62 GLN n 1 63 ILE n 1 64 THR n 1 65 GLY n 1 66 LEU n 1 67 ILE n 1 68 GLU n 1 69 VAL n 1 70 ASN n 1 71 GLU n 1 72 LYS n 1 73 GLU n 1 74 LEU n 1 75 ASP n 1 76 ALA n 1 77 THR n 1 78 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene MLC1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MLC1_YEAST _struct_ref.pdbx_db_accession P53141 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FCD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P53141 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM Mlc1p 15N, 13C; 50 mM phosphate buffer, Sodium Chloride 0.1 M; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '50 mM phosphate buffer, Sodium Chloride 0.1 M; 90% H2O, 10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2FCD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2FCD _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' NMRView 5.2.2 'Bruce A. Johnson' 1 collection XwinNMR ? ? 2 refinement Xplor-NIH 2.12 'G.M. Clore' 3 # _exptl.entry_id 2FCD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2FCD _struct.title 'Solution structure of N-lobe Myosin Light Chain from Saccharomices cerevisiae' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FCD _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'EF-HAND PROTEIN, CELL CYCLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 2 ? ASP A 14 ? ALA A 3 ASP A 15 1 ? 13 HELX_P HELX_P2 2 SER A 25 ? GLY A 34 ? SER A 26 GLY A 35 1 ? 10 HELX_P HELX_P3 3 THR A 38 ? ALA A 48 ? THR A 39 ALA A 49 1 ? 11 HELX_P HELX_P4 4 LEU A 60 ? GLU A 68 ? LEU A 61 GLU A 69 1 ? 9 HELX_P HELX_P5 5 ASN A 70 ? THR A 77 ? ASN A 71 THR A 78 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 20 ? ALA A 22 ? ALA A 21 ALA A 23 A 2 SER A 57 ? THR A 59 ? SER A 58 THR A 60 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 58 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 59 # _database_PDB_matrix.entry_id 2FCD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FCD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 ALA 2 3 3 ALA ALA A . n A 1 3 THR 3 4 4 THR THR A . n A 1 4 ARG 4 5 5 ARG ARG A . n A 1 5 ALA 5 6 6 ALA ALA A . n A 1 6 ASN 6 7 7 ASN ASN A . n A 1 7 LYS 7 8 8 LYS LYS A . n A 1 8 ASP 8 9 9 ASP ASP A . n A 1 9 ILE 9 10 10 ILE ILE A . n A 1 10 PHE 10 11 11 PHE PHE A . n A 1 11 THR 11 12 12 THR THR A . n A 1 12 LEU 12 13 13 LEU LEU A . n A 1 13 PHE 13 14 14 PHE PHE A . n A 1 14 ASP 14 15 15 ASP ASP A . n A 1 15 LYS 15 16 16 LYS LYS A . n A 1 16 LYS 16 17 17 LYS LYS A . n A 1 17 GLY 17 18 18 GLY GLY A . n A 1 18 GLN 18 19 19 GLN GLN A . n A 1 19 GLY 19 20 20 GLY GLY A . n A 1 20 ALA 20 21 21 ALA ALA A . n A 1 21 ILE 21 22 22 ILE ILE A . n A 1 22 ALA 22 23 23 ALA ALA A . n A 1 23 LYS 23 24 24 LYS LYS A . n A 1 24 ASP 24 25 25 ASP ASP A . n A 1 25 SER 25 26 26 SER SER A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 GLY 27 28 28 GLY GLY A . n A 1 28 ASP 28 29 29 ASP ASP A . n A 1 29 TYR 29 30 30 TYR TYR A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 ARG 31 32 32 ARG ARG A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 ILE 33 34 34 ILE ILE A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 TYR 35 36 36 TYR TYR A . n A 1 36 ASN 36 37 37 ASN ASN A . n A 1 37 PRO 37 38 38 PRO PRO A . n A 1 38 THR 38 39 39 THR THR A . n A 1 39 ASN 39 40 40 ASN ASN A . n A 1 40 GLN 40 41 41 GLN GLN A . n A 1 41 LEU 41 42 42 LEU LEU A . n A 1 42 VAL 42 43 43 VAL VAL A . n A 1 43 GLN 43 44 44 GLN GLN A . n A 1 44 ASP 44 45 45 ASP ASP A . n A 1 45 ILE 45 46 46 ILE ILE A . n A 1 46 ILE 46 47 47 ILE ILE A . n A 1 47 ASN 47 48 48 ASN ASN A . n A 1 48 ALA 48 49 49 ALA ALA A . n A 1 49 ASP 49 50 50 ASP ASP A . n A 1 50 SER 50 51 51 SER SER A . n A 1 51 SER 51 52 52 SER SER A . n A 1 52 LEU 52 53 53 LEU LEU A . n A 1 53 ARG 53 54 54 ARG ARG A . n A 1 54 ASP 54 55 55 ASP ASP A . n A 1 55 ALA 55 56 56 ALA ALA A . n A 1 56 SER 56 57 57 SER SER A . n A 1 57 SER 57 58 58 SER SER A . n A 1 58 LEU 58 59 59 LEU LEU A . n A 1 59 THR 59 60 60 THR THR A . n A 1 60 LEU 60 61 61 LEU LEU A . n A 1 61 ASP 61 62 62 ASP ASP A . n A 1 62 GLN 62 63 63 GLN GLN A . n A 1 63 ILE 63 64 64 ILE ILE A . n A 1 64 THR 64 65 65 THR THR A . n A 1 65 GLY 65 66 66 GLY GLY A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 ILE 67 68 68 ILE ILE A . n A 1 68 GLU 68 69 69 GLU GLU A . n A 1 69 VAL 69 70 70 VAL VAL A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 GLU 71 72 72 GLU GLU A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 GLU 73 74 74 GLU GLU A . n A 1 74 LEU 74 75 75 LEU LEU A . n A 1 75 ASP 75 76 76 ASP ASP A . n A 1 76 ALA 76 77 77 ALA ALA A . n A 1 77 THR 77 78 78 THR THR A . n A 1 78 THR 78 79 79 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-07 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 21 ? ? -167.38 118.01 2 1 PRO A 38 ? ? -73.87 -165.74 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 5 ? ? 0.281 'SIDE CHAIN' 2 1 ARG A 32 ? ? 0.251 'SIDE CHAIN' 3 1 ARG A 54 ? ? 0.312 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 79 ? C ? A THR 78 C 2 1 Y 1 A THR 79 ? O ? A THR 78 O #