data_2FFG # _entry.id 2FFG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2FFG RCSB RCSB035815 WWPDB D_1000035815 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SR360 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FFG _pdbx_database_status.recvd_initial_deposition_date 2005-12-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.P.' 1 'Abashidze, M.' 2 'Forouhar, F.' 3 'Vorobiev, S.M.' 4 'Ho, C.K.' 5 'Janjua, H.' 6 'Cunningham, K.' 7 'Conover, K.' 8 'Ma, L.C.' 9 'Xiao, R.' 10 'Acton, T.B.' 11 'Montelione, G.T.' 12 'Tong, L.' 13 'Hunt, J.F.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.P.' 1 primary 'Abashidze, M.' 2 primary 'Forouhar, F.' 3 primary 'Vorobiev, S.M.' 4 primary 'Ho, C.K.' 5 primary 'Janjua, H.' 6 primary 'Cunningham, K.' 7 primary 'Conover, K.' 8 primary 'Ma, L.C.' 9 primary 'Xiao, R.' 10 primary 'Acton, T.B.' 11 primary 'Montelione, G.T.' 12 primary 'Tong, L.' 13 primary 'Hunt, J.F.' 14 primary 'Northeast Structural Genomics Consortium (NESG)' 15 # _cell.entry_id 2FFG _cell.length_a 85.915 _cell.length_b 85.915 _cell.length_c 51.377 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FFG _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ykuJ 10510.231 2 ? ? ? ? 2 water nat water 18.015 67 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SQL(MSE)GIITRLQSLQETAEAANEP(MSE)QRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNID (MSE)VSIEIFELLQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQL EHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier SR360 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 GLN n 1 4 LEU n 1 5 MSE n 1 6 GLY n 1 7 ILE n 1 8 ILE n 1 9 THR n 1 10 ARG n 1 11 LEU n 1 12 GLN n 1 13 SER n 1 14 LEU n 1 15 GLN n 1 16 GLU n 1 17 THR n 1 18 ALA n 1 19 GLU n 1 20 ALA n 1 21 ALA n 1 22 ASN n 1 23 GLU n 1 24 PRO n 1 25 MSE n 1 26 GLN n 1 27 ARG n 1 28 TYR n 1 29 PHE n 1 30 GLU n 1 31 VAL n 1 32 ASN n 1 33 GLY n 1 34 GLU n 1 35 LYS n 1 36 ILE n 1 37 CYS n 1 38 SER n 1 39 VAL n 1 40 LYS n 1 41 TYR n 1 42 PHE n 1 43 GLU n 1 44 LYS n 1 45 ASN n 1 46 GLN n 1 47 THR n 1 48 PHE n 1 49 GLU n 1 50 LEU n 1 51 THR n 1 52 VAL n 1 53 PHE n 1 54 GLN n 1 55 LYS n 1 56 GLY n 1 57 GLU n 1 58 LYS n 1 59 PRO n 1 60 ASN n 1 61 THR n 1 62 TYR n 1 63 PRO n 1 64 PHE n 1 65 ASP n 1 66 ASN n 1 67 ILE n 1 68 ASP n 1 69 MSE n 1 70 VAL n 1 71 SER n 1 72 ILE n 1 73 GLU n 1 74 ILE n 1 75 PHE n 1 76 GLU n 1 77 LEU n 1 78 LEU n 1 79 GLN n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ykuJ _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) + Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O34588_BACSU _struct_ref.pdbx_db_accession O34588 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2FFG A 1 ? 79 ? O34588 1 ? 79 ? 1 79 2 1 2FFG B 1 ? 79 ? O34588 1 ? 79 ? 1 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FFG MSE A 1 ? UNP O34588 MET 1 'MODIFIED RESIDUE' 1 1 1 2FFG MSE A 5 ? UNP O34588 MET 5 'MODIFIED RESIDUE' 5 2 1 2FFG MSE A 25 ? UNP O34588 MET 25 'MODIFIED RESIDUE' 25 3 1 2FFG MSE A 69 ? UNP O34588 MET 69 'MODIFIED RESIDUE' 69 4 1 2FFG LEU A 80 ? UNP O34588 ? ? 'CLONING ARTIFACT' 80 5 1 2FFG GLU A 81 ? UNP O34588 ? ? 'CLONING ARTIFACT' 81 6 1 2FFG HIS A 82 ? UNP O34588 ? ? 'EXPRESSION TAG' 82 7 1 2FFG HIS A 83 ? UNP O34588 ? ? 'EXPRESSION TAG' 83 8 1 2FFG HIS A 84 ? UNP O34588 ? ? 'EXPRESSION TAG' 84 9 1 2FFG HIS A 85 ? UNP O34588 ? ? 'EXPRESSION TAG' 85 10 1 2FFG HIS A 86 ? UNP O34588 ? ? 'EXPRESSION TAG' 86 11 1 2FFG HIS A 87 ? UNP O34588 ? ? 'EXPRESSION TAG' 87 12 2 2FFG MSE B 1 ? UNP O34588 MET 1 'MODIFIED RESIDUE' 1 13 2 2FFG MSE B 5 ? UNP O34588 MET 5 'MODIFIED RESIDUE' 5 14 2 2FFG MSE B 25 ? UNP O34588 MET 25 'MODIFIED RESIDUE' 25 15 2 2FFG MSE B 69 ? UNP O34588 MET 69 'MODIFIED RESIDUE' 69 16 2 2FFG LEU B 80 ? UNP O34588 ? ? 'CLONING ARTIFACT' 80 17 2 2FFG GLU B 81 ? UNP O34588 ? ? 'CLONING ARTIFACT' 81 18 2 2FFG HIS B 82 ? UNP O34588 ? ? 'EXPRESSION TAG' 82 19 2 2FFG HIS B 83 ? UNP O34588 ? ? 'EXPRESSION TAG' 83 20 2 2FFG HIS B 84 ? UNP O34588 ? ? 'EXPRESSION TAG' 84 21 2 2FFG HIS B 85 ? UNP O34588 ? ? 'EXPRESSION TAG' 85 22 2 2FFG HIS B 86 ? UNP O34588 ? ? 'EXPRESSION TAG' 86 23 2 2FFG HIS B 87 ? UNP O34588 ? ? 'EXPRESSION TAG' 87 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FFG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_percent_sol 45.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '200 mM Ca-acetate, 18% PEG3350, 100 mM Na-Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-11-20 _diffrn_detector.details Mirror # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 2FFG _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.3 _reflns.number_obs 16008 _reflns.number_all 16561 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.5 _reflns.B_iso_Wilson_estimate 37.6 _reflns.pdbx_redundancy 8.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 97.8 _reflns_shell.Rmerge_I_obs 0.319 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.7 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2FFG _refine.ls_number_reflns_obs 15080 _refine.ls_number_reflns_all 16008 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 356919.82 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.82 _refine.ls_d_res_high 2.31 _refine.ls_percent_reflns_obs 93.8 _refine.ls_R_factor_obs 0.241 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.241 _refine.ls_R_factor_R_free 0.26 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 740 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 39.5 _refine.aniso_B[1][1] 0.40 _refine.aniso_B[2][2] 0.40 _refine.aniso_B[3][3] -0.81 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.292296 _refine.solvent_model_param_bsol 24.3946 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2FFG _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.26 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.14 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1303 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1370 _refine_hist.d_res_high 2.31 _refine_hist.d_res_low 19.82 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.77 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.44 _refine_ls_shell.number_reflns_R_work 1929 _refine_ls_shell.R_factor_R_work 0.271 _refine_ls_shell.percent_reflns_obs 74.7 _refine_ls_shell.R_factor_R_free 0.258 _refine_ls_shell.R_factor_R_free_error 0.024 _refine_ls_shell.percent_reflns_R_free 5.7 _refine_ls_shell.number_reflns_R_free 117 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' 4 PARM_HOME:acy.par PARM_HOME:acy.top 'X-RAY DIFFRACTION' # _struct.entry_id 2FFG _struct.title 'Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.' _struct.pdbx_descriptor ykuJ _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FFG _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;X-Ray SR360 NESG YkuJ, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? ASN A 22 ? SER A 2 ASN A 22 1 ? 21 HELX_P HELX_P2 2 ASN A 66 ? LEU A 80 ? ASN A 66 LEU A 80 1 ? 15 HELX_P HELX_P3 3 SER B 2 ? GLU B 19 ? SER B 2 GLU B 19 1 ? 18 HELX_P HELX_P4 4 ASN B 66 ? LEU B 80 ? ASN B 66 LEU B 80 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 4 C ? ? ? 1_555 A MSE 5 N ? ? A LEU 4 A MSE 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A MSE 5 C ? ? ? 1_555 A GLY 6 N ? ? A MSE 5 A GLY 6 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? A PRO 24 C ? ? ? 1_555 A MSE 25 N ? ? A PRO 24 A MSE 25 1_555 ? ? ? ? ? ? ? 1.326 ? covale4 covale ? ? A MSE 25 C ? ? ? 1_555 A GLN 26 N ? ? A MSE 25 A GLN 26 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A ASP 68 C ? ? ? 1_555 A MSE 69 N ? ? A ASP 68 A MSE 69 1_555 ? ? ? ? ? ? ? 1.327 ? covale6 covale ? ? A MSE 69 C ? ? ? 1_555 A VAL 70 N ? ? A MSE 69 A VAL 70 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? B LEU 4 C ? ? ? 1_555 B MSE 5 N ? ? B LEU 4 B MSE 5 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale ? ? B MSE 5 C ? ? ? 1_555 B GLY 6 N ? ? B MSE 5 B GLY 6 1_555 ? ? ? ? ? ? ? 1.332 ? covale9 covale ? ? B PRO 24 C ? ? ? 1_555 B MSE 25 N ? ? B PRO 24 B MSE 25 1_555 ? ? ? ? ? ? ? 1.334 ? covale10 covale ? ? B MSE 25 C ? ? ? 1_555 B GLN 26 N ? ? B MSE 25 B GLN 26 1_555 ? ? ? ? ? ? ? 1.339 ? covale11 covale ? ? B ASP 68 C ? ? ? 1_555 B MSE 69 N ? ? B ASP 68 B MSE 69 1_555 ? ? ? ? ? ? ? 1.328 ? covale12 covale ? ? B MSE 69 C ? ? ? 1_555 B VAL 70 N ? ? B MSE 69 B VAL 70 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MSE A 25 ? VAL A 31 ? MSE A 25 VAL A 31 A 2 GLU A 34 ? PHE A 42 ? GLU A 34 PHE A 42 A 3 THR A 47 ? GLN A 54 ? THR A 47 GLN A 54 A 4 GLU A 57 ? PHE A 64 ? GLU A 57 PHE A 64 B 1 MSE B 25 ? VAL B 31 ? MSE B 25 VAL B 31 B 2 GLU B 34 ? PHE B 42 ? GLU B 34 PHE B 42 B 3 THR B 47 ? VAL B 52 ? THR B 47 VAL B 52 B 4 ASN B 60 ? PHE B 64 ? ASN B 60 PHE B 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MSE A 25 ? N MSE A 25 O TYR A 41 ? O TYR A 41 A 2 3 N LYS A 40 ? N LYS A 40 O GLU A 49 ? O GLU A 49 A 3 4 N PHE A 48 ? N PHE A 48 O PHE A 64 ? O PHE A 64 B 1 2 N ARG B 27 ? N ARG B 27 O VAL B 39 ? O VAL B 39 B 2 3 N SER B 38 ? N SER B 38 O THR B 51 ? O THR B 51 B 3 4 N PHE B 48 ? N PHE B 48 O PHE B 64 ? O PHE B 64 # _database_PDB_matrix.entry_id 2FFG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FFG _atom_sites.fract_transf_matrix[1][1] 0.011639 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011639 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019464 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 MSE 5 5 5 MSE MSE A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 MSE 25 25 25 MSE MSE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 MSE 69 69 69 MSE MSE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 HIS 82 82 ? ? ? A . n A 1 83 HIS 83 83 ? ? ? A . n A 1 84 HIS 84 84 ? ? ? A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 GLN 3 3 3 GLN GLN B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 MSE 5 5 5 MSE MSE B . n B 1 6 GLY 6 6 6 GLY GLY B . n B 1 7 ILE 7 7 7 ILE ILE B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 THR 9 9 9 THR THR B . n B 1 10 ARG 10 10 10 ARG ARG B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 THR 17 17 17 THR THR B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 PRO 24 24 24 PRO PRO B . n B 1 25 MSE 25 25 25 MSE MSE B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 ARG 27 27 27 ARG ARG B . n B 1 28 TYR 28 28 28 TYR TYR B . n B 1 29 PHE 29 29 29 PHE PHE B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 ASN 32 32 32 ASN ASN B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 CYS 37 37 37 CYS CYS B . n B 1 38 SER 38 38 38 SER SER B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 TYR 41 41 41 TYR TYR B . n B 1 42 PHE 42 42 42 PHE PHE B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 GLN 46 46 46 GLN GLN B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 PHE 48 48 48 PHE PHE B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 THR 51 51 51 THR THR B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 GLN 54 54 54 GLN GLN B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 GLY 56 56 56 GLY GLY B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 PRO 59 59 59 PRO PRO B . n B 1 60 ASN 60 60 60 ASN ASN B . n B 1 61 THR 61 61 61 THR THR B . n B 1 62 TYR 62 62 62 TYR TYR B . n B 1 63 PRO 63 63 63 PRO PRO B . n B 1 64 PHE 64 64 64 PHE PHE B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 ASN 66 66 66 ASN ASN B . n B 1 67 ILE 67 67 67 ILE ILE B . n B 1 68 ASP 68 68 68 ASP ASP B . n B 1 69 MSE 69 69 69 MSE MSE B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 ILE 74 74 74 ILE ILE B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 LEU 77 77 77 LEU LEU B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 GLN 79 79 79 GLN GLN B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 GLU 81 81 ? ? ? B . n B 1 82 HIS 82 82 ? ? ? B . n B 1 83 HIS 83 83 ? ? ? B . n B 1 84 HIS 84 84 ? ? ? B . n B 1 85 HIS 85 85 ? ? ? B . n B 1 86 HIS 86 86 ? ? ? B . n B 1 87 HIS 87 87 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 101 HOH TIP A . C 2 HOH 2 102 102 HOH TIP A . C 2 HOH 3 103 103 HOH TIP A . C 2 HOH 4 104 104 HOH TIP A . C 2 HOH 5 105 105 HOH TIP A . C 2 HOH 6 106 106 HOH TIP A . C 2 HOH 7 107 107 HOH TIP A . C 2 HOH 8 108 108 HOH TIP A . C 2 HOH 9 109 109 HOH TIP A . C 2 HOH 10 110 110 HOH TIP A . C 2 HOH 11 111 1 HOH WAT A . C 2 HOH 12 112 2 HOH WAT A . C 2 HOH 13 113 3 HOH WAT A . C 2 HOH 14 114 4 HOH WAT A . C 2 HOH 15 115 6 HOH WAT A . C 2 HOH 16 116 7 HOH WAT A . C 2 HOH 17 117 8 HOH WAT A . C 2 HOH 18 118 9 HOH WAT A . C 2 HOH 19 119 10 HOH WAT A . C 2 HOH 20 120 11 HOH WAT A . C 2 HOH 21 121 13 HOH WAT A . C 2 HOH 22 122 14 HOH WAT A . C 2 HOH 23 123 15 HOH WAT A . C 2 HOH 24 124 16 HOH WAT A . C 2 HOH 25 125 18 HOH WAT A . C 2 HOH 26 126 19 HOH WAT A . C 2 HOH 27 127 20 HOH WAT A . C 2 HOH 28 128 22 HOH WAT A . C 2 HOH 29 129 26 HOH WAT A . C 2 HOH 30 130 28 HOH WAT A . C 2 HOH 31 131 29 HOH WAT A . C 2 HOH 32 132 30 HOH WAT A . C 2 HOH 33 133 35 HOH WAT A . C 2 HOH 34 134 36 HOH WAT A . C 2 HOH 35 135 38 HOH WAT A . C 2 HOH 36 136 39 HOH WAT A . C 2 HOH 37 137 41 HOH WAT A . C 2 HOH 38 138 42 HOH WAT A . C 2 HOH 39 139 44 HOH WAT A . C 2 HOH 40 140 46 HOH WAT A . C 2 HOH 41 141 47 HOH WAT A . C 2 HOH 42 142 48 HOH WAT A . C 2 HOH 43 143 50 HOH WAT A . C 2 HOH 44 144 51 HOH WAT A . C 2 HOH 45 145 53 HOH WAT A . C 2 HOH 46 146 55 HOH WAT A . D 2 HOH 1 88 5 HOH WAT B . D 2 HOH 2 89 12 HOH WAT B . D 2 HOH 3 90 17 HOH WAT B . D 2 HOH 4 91 21 HOH WAT B . D 2 HOH 5 92 23 HOH WAT B . D 2 HOH 6 93 24 HOH WAT B . D 2 HOH 7 94 25 HOH WAT B . D 2 HOH 8 95 27 HOH WAT B . D 2 HOH 9 96 31 HOH WAT B . D 2 HOH 10 97 32 HOH WAT B . D 2 HOH 11 98 33 HOH WAT B . D 2 HOH 12 99 34 HOH WAT B . D 2 HOH 13 100 37 HOH WAT B . D 2 HOH 14 101 40 HOH WAT B . D 2 HOH 15 102 43 HOH WAT B . D 2 HOH 16 103 45 HOH WAT B . D 2 HOH 17 104 49 HOH WAT B . D 2 HOH 18 105 52 HOH WAT B . D 2 HOH 19 106 54 HOH WAT B . D 2 HOH 20 107 56 HOH WAT B . D 2 HOH 21 108 57 HOH WAT B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 5 A MSE 5 ? MET SELENOMETHIONINE 2 A MSE 25 A MSE 25 ? MET SELENOMETHIONINE 3 A MSE 69 A MSE 69 ? MET SELENOMETHIONINE 4 B MSE 5 B MSE 5 ? MET SELENOMETHIONINE 5 B MSE 25 B MSE 25 ? MET SELENOMETHIONINE 6 B MSE 69 B MSE 69 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-27 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 110 ? ? 1_555 O A HOH 110 ? ? 7_556 1.17 2 1 OD1 A ASN 22 ? ? 1_555 OD1 A ASN 22 ? ? 7_556 1.94 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 45 ? ? 158.08 -145.95 2 1 ALA B 20 ? ? -149.72 -10.29 3 1 ALA B 21 ? ? -152.01 9.25 4 1 PRO B 24 ? ? -55.68 170.50 5 1 ASN B 45 ? ? -177.58 -40.90 6 1 GLN B 46 ? ? 73.01 36.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A HIS 82 ? A HIS 82 3 1 Y 1 A HIS 83 ? A HIS 83 4 1 Y 1 A HIS 84 ? A HIS 84 5 1 Y 1 A HIS 85 ? A HIS 85 6 1 Y 1 A HIS 86 ? A HIS 86 7 1 Y 1 A HIS 87 ? A HIS 87 8 1 Y 1 B MSE 1 ? B MSE 1 9 1 Y 1 B GLU 81 ? B GLU 81 10 1 Y 1 B HIS 82 ? B HIS 82 11 1 Y 1 B HIS 83 ? B HIS 83 12 1 Y 1 B HIS 84 ? B HIS 84 13 1 Y 1 B HIS 85 ? B HIS 85 14 1 Y 1 B HIS 86 ? B HIS 86 15 1 Y 1 B HIS 87 ? B HIS 87 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #