data_2FFW # _entry.id 2FFW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FFW pdb_00002ffw 10.2210/pdb2ffw/pdb RCSB RCSB035830 ? ? WWPDB D_1000035830 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-09 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FFW _pdbx_database_status.recvd_initial_deposition_date 2005-12-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Massiah, M.A.' 1 'Simmons, B.N.' 2 'Short, K.M.' 3 'Cox, T.C.' 4 # _citation.id primary _citation.title 'Solution Structure of the RBCC/TRIM B-box1 Domain of Human MID1: B-box with a RING.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 358 _citation.page_first 532 _citation.page_last 545 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16529770 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.02.009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Massiah, M.A.' 1 ? primary 'Simmons, B.N.' 2 ? primary 'Short, K.M.' 3 ? primary 'Cox, T.C.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Midline-1 8630.673 1 6.3.2.- ? 'B-box 1 domain (RESIDUES: 87 - 164)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tripartite motif protein 18, Putative transcription factor XPRF, Midin, RING finger protein 59' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP _entity_poly.pdbx_seq_one_letter_code_can QKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 LYS n 1 3 ALA n 1 4 SER n 1 5 VAL n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ASN n 1 10 SER n 1 11 PRO n 1 12 SER n 1 13 GLU n 1 14 THR n 1 15 ARG n 1 16 ARG n 1 17 GLU n 1 18 ARG n 1 19 ALA n 1 20 PHE n 1 21 ASP n 1 22 ALA n 1 23 ASN n 1 24 THR n 1 25 MET n 1 26 THR n 1 27 SER n 1 28 ALA n 1 29 GLU n 1 30 LYS n 1 31 VAL n 1 32 LEU n 1 33 CYS n 1 34 GLN n 1 35 PHE n 1 36 CYS n 1 37 ASP n 1 38 GLN n 1 39 ASP n 1 40 PRO n 1 41 ALA n 1 42 GLN n 1 43 ASP n 1 44 ALA n 1 45 VAL n 1 46 LYS n 1 47 THR n 1 48 CYS n 1 49 VAL n 1 50 THR n 1 51 CYS n 1 52 GLU n 1 53 VAL n 1 54 SER n 1 55 TYR n 1 56 CYS n 1 57 ASP n 1 58 GLU n 1 59 CYS n 1 60 LEU n 1 61 LYS n 1 62 ALA n 1 63 THR n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 LYS n 1 68 LYS n 1 69 PRO n 1 70 PHE n 1 71 THR n 1 72 GLY n 1 73 HIS n 1 74 ARG n 1 75 LEU n 1 76 ILE n 1 77 GLU n 1 78 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'MID1, FXY, RNF59, TRIM18, XPRF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 87 87 GLN GLN A . n A 1 2 LYS 2 88 88 LYS LYS A . n A 1 3 ALA 3 89 89 ALA ALA A . n A 1 4 SER 4 90 90 SER SER A . n A 1 5 VAL 5 91 91 VAL VAL A . n A 1 6 SER 6 92 92 SER SER A . n A 1 7 GLY 7 93 93 GLY GLY A . n A 1 8 PRO 8 94 94 PRO PRO A . n A 1 9 ASN 9 95 95 ASN ASN A . n A 1 10 SER 10 96 96 SER SER A . n A 1 11 PRO 11 97 97 PRO PRO A . n A 1 12 SER 12 98 98 SER SER A . n A 1 13 GLU 13 99 99 GLU GLU A . n A 1 14 THR 14 100 100 THR THR A . n A 1 15 ARG 15 101 101 ARG ARG A . n A 1 16 ARG 16 102 102 ARG ARG A . n A 1 17 GLU 17 103 103 GLU GLU A . n A 1 18 ARG 18 104 104 ARG ARG A . n A 1 19 ALA 19 105 105 ALA ALA A . n A 1 20 PHE 20 106 106 PHE PHE A . n A 1 21 ASP 21 107 107 ASP ASP A . n A 1 22 ALA 22 108 108 ALA ALA A . n A 1 23 ASN 23 109 109 ASN ASN A . n A 1 24 THR 24 110 110 THR THR A . n A 1 25 MET 25 111 111 MET MET A . n A 1 26 THR 26 112 112 THR THR A . n A 1 27 SER 27 113 113 SER SER A . n A 1 28 ALA 28 114 114 ALA ALA A . n A 1 29 GLU 29 115 115 GLU GLU A . n A 1 30 LYS 30 116 116 LYS LYS A . n A 1 31 VAL 31 117 117 VAL VAL A . n A 1 32 LEU 32 118 118 LEU LEU A . n A 1 33 CYS 33 119 119 CYS CYS A . n A 1 34 GLN 34 120 120 GLN GLN A . n A 1 35 PHE 35 121 121 PHE PHE A . n A 1 36 CYS 36 122 122 CYS CYS A . n A 1 37 ASP 37 123 123 ASP ASP A . n A 1 38 GLN 38 124 124 GLN GLN A . n A 1 39 ASP 39 125 125 ASP ASP A . n A 1 40 PRO 40 126 126 PRO PRO A . n A 1 41 ALA 41 127 127 ALA ALA A . n A 1 42 GLN 42 128 128 GLN GLN A . n A 1 43 ASP 43 129 129 ASP ASP A . n A 1 44 ALA 44 130 130 ALA ALA A . n A 1 45 VAL 45 131 131 VAL VAL A . n A 1 46 LYS 46 132 132 LYS LYS A . n A 1 47 THR 47 133 133 THR THR A . n A 1 48 CYS 48 134 134 CYS CYS A . n A 1 49 VAL 49 135 135 VAL VAL A . n A 1 50 THR 50 136 136 THR THR A . n A 1 51 CYS 51 137 137 CYS CYS A . n A 1 52 GLU 52 138 138 GLU GLU A . n A 1 53 VAL 53 139 139 VAL VAL A . n A 1 54 SER 54 140 140 SER SER A . n A 1 55 TYR 55 141 141 TYR TYR A . n A 1 56 CYS 56 142 142 CYS CYS A . n A 1 57 ASP 57 143 143 ASP ASP A . n A 1 58 GLU 58 144 144 GLU GLU A . n A 1 59 CYS 59 145 145 CYS CYS A . n A 1 60 LEU 60 146 146 LEU LEU A . n A 1 61 LYS 61 147 147 LYS LYS A . n A 1 62 ALA 62 148 148 ALA ALA A . n A 1 63 THR 63 149 149 THR THR A . n A 1 64 HIS 64 150 150 HIS HIS A . n A 1 65 PRO 65 151 151 PRO PRO A . n A 1 66 ASN 66 152 152 ASN ASN A . n A 1 67 LYS 67 153 153 LYS LYS A . n A 1 68 LYS 68 154 154 LYS LYS A . n A 1 69 PRO 69 155 155 PRO PRO A . n A 1 70 PHE 70 156 156 PHE PHE A . n A 1 71 THR 71 157 157 THR THR A . n A 1 72 GLY 72 158 158 GLY GLY A . n A 1 73 HIS 73 159 159 HIS HIS A . n A 1 74 ARG 74 160 160 ARG ARG A . n A 1 75 LEU 75 161 161 LEU LEU A . n A 1 76 ILE 76 162 162 ILE ILE A . n A 1 77 GLU 77 163 163 GLU GLU A . n A 1 78 PRO 78 164 164 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 119 ZN CYS A . C 2 ZN 1 201 134 ZN CYS A . # _exptl.entry_id 2FFW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2FFW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2FFW _struct.title 'Solution structure of the RBCC/TRIM B-box1 domain of human MID1: B-box with a RING' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FFW _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'B-box, MID1, RING FINGER, Zinc-finger, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI18_HUMAN _struct_ref.pdbx_db_accession O15344 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 87 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FFW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15344 _struct_ref_seq.db_align_beg 87 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 87 _struct_ref_seq.pdbx_auth_seq_align_end 164 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 142 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 150 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 119 A ZN 200 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc2 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 122 A ZN 200 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc3 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 134 A ZN 201 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc4 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 137 A ZN 201 1_555 ? ? ? ? ? ? ? 2.436 ? ? metalc5 metalc ? ? A CYS 56 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 142 A ZN 200 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc6 metalc ? ? A CYS 59 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 145 A ZN 200 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc7 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 150 A ZN 201 1_555 ? ? ? ? ? ? ? 2.135 ? ? metalc8 metalc ? ? A HIS 73 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 159 A ZN 201 1_555 ? ? ? ? ? ? ? 2.144 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 33 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 36 ? A CYS 122 ? 1_555 110.6 ? 2 SG ? A CYS 33 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 56 ? A CYS 142 ? 1_555 112.1 ? 3 SG ? A CYS 36 ? A CYS 122 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 56 ? A CYS 142 ? 1_555 108.7 ? 4 SG ? A CYS 33 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 59 ? A CYS 145 ? 1_555 109.8 ? 5 SG ? A CYS 36 ? A CYS 122 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 59 ? A CYS 145 ? 1_555 107.6 ? 6 SG ? A CYS 56 ? A CYS 142 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 59 ? A CYS 145 ? 1_555 107.9 ? 7 SG ? A CYS 48 ? A CYS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 137 ? 1_555 107.6 ? 8 SG ? A CYS 48 ? A CYS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 64 ? A HIS 150 ? 1_555 118.8 ? 9 SG ? A CYS 51 ? A CYS 137 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 64 ? A HIS 150 ? 1_555 113.4 ? 10 SG ? A CYS 48 ? A CYS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 73 ? A HIS 159 ? 1_555 117.9 ? 11 SG ? A CYS 51 ? A CYS 137 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 73 ? A HIS 159 ? 1_555 112.8 ? 12 NE2 ? A HIS 64 ? A HIS 150 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 73 ? A HIS 159 ? 1_555 85.1 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 1 0.03 2 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 1 -0.06 3 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 2 0.01 4 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 2 -0.09 5 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 3 0.14 6 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 3 -0.05 7 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 4 -0.03 8 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 4 -0.15 9 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 5 -0.07 10 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 5 0.10 11 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 6 -0.01 12 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 6 -0.16 13 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 7 0.13 14 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 7 0.00 15 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 8 0.07 16 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 8 -0.14 17 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 9 0.00 18 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 9 -0.12 19 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 10 0.04 20 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 10 -0.15 21 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 11 -0.02 22 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 11 -0.12 23 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 12 0.05 24 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 12 -0.14 25 ASP 39 A . ? ASP 125 A PRO 40 A ? PRO 126 A 13 -0.04 26 LYS 68 A . ? LYS 154 A PRO 69 A ? PRO 155 A 13 -0.10 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 46 ? CYS A 48 ? LYS A 132 CYS A 134 A 2 VAL A 53 ? TYR A 55 ? VAL A 139 TYR A 141 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 132 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 55 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 141 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 33 ? CYS A 119 . ? 1_555 ? 2 AC1 4 CYS A 36 ? CYS A 122 . ? 1_555 ? 3 AC1 4 CYS A 56 ? CYS A 142 . ? 1_555 ? 4 AC1 4 CYS A 59 ? CYS A 145 . ? 1_555 ? 5 AC2 4 CYS A 48 ? CYS A 134 . ? 1_555 ? 6 AC2 4 CYS A 51 ? CYS A 137 . ? 1_555 ? 7 AC2 4 HIS A 64 ? HIS A 150 . ? 1_555 ? 8 AC2 4 HIS A 73 ? HIS A 159 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 96 ? ? -157.62 69.99 2 1 SER A 98 ? ? -65.61 98.52 3 1 GLU A 103 ? ? -162.67 104.55 4 1 PHE A 106 ? ? -154.95 76.05 5 1 ALA A 108 ? ? -63.11 -178.43 6 1 SER A 113 ? ? -161.42 -66.34 7 1 GLU A 115 ? ? -130.25 -68.14 8 1 LYS A 116 ? ? 63.08 -173.57 9 1 ASP A 123 ? ? -147.55 26.81 10 1 ASP A 125 ? ? 60.43 85.53 11 1 CYS A 142 ? ? -101.57 -159.24 12 1 HIS A 150 ? ? -113.50 72.95 13 1 PRO A 151 ? ? -69.77 85.03 14 1 LYS A 154 ? ? 62.68 161.32 15 1 PHE A 156 ? ? -162.01 43.37 16 1 THR A 157 ? ? -90.24 46.84 17 2 LYS A 88 ? ? 60.75 -171.76 18 2 SER A 92 ? ? -163.88 91.43 19 2 PRO A 97 ? ? -69.82 87.84 20 2 GLU A 103 ? ? 59.95 97.11 21 2 ASP A 107 ? ? -60.76 -174.02 22 2 ALA A 114 ? ? 63.57 88.11 23 2 GLU A 115 ? ? -130.41 -67.79 24 2 ASP A 123 ? ? -148.53 27.22 25 2 ASP A 125 ? ? 61.66 85.70 26 2 CYS A 142 ? ? -104.10 -160.45 27 2 HIS A 150 ? ? -113.71 72.56 28 2 LYS A 154 ? ? 62.60 161.42 29 2 PHE A 156 ? ? -161.61 66.67 30 2 THR A 157 ? ? -96.06 40.60 31 3 SER A 98 ? ? -95.70 -70.70 32 3 ARG A 104 ? ? -174.86 147.08 33 3 ALA A 105 ? ? -142.97 -68.44 34 3 ALA A 108 ? ? 62.88 162.98 35 3 ASN A 109 ? ? -174.80 62.69 36 3 THR A 110 ? ? 64.13 158.47 37 3 ALA A 114 ? ? 62.00 176.71 38 3 GLU A 115 ? ? -121.20 -68.10 39 3 ASP A 123 ? ? -151.05 26.52 40 3 ASP A 125 ? ? 63.32 86.01 41 3 CYS A 142 ? ? -101.54 -159.26 42 3 HIS A 150 ? ? -113.57 72.74 43 3 ASN A 152 ? ? 179.75 -174.47 44 3 LYS A 154 ? ? 62.59 161.14 45 3 HIS A 159 ? ? -78.74 -169.13 46 4 ASN A 95 ? ? -69.03 -171.91 47 4 ASN A 109 ? ? -59.81 100.84 48 4 SER A 113 ? ? -60.45 -172.81 49 4 GLU A 115 ? ? -96.77 -68.20 50 4 ASP A 123 ? ? -140.12 26.26 51 4 ASP A 125 ? ? 63.41 85.78 52 4 CYS A 142 ? ? -100.75 -159.70 53 4 HIS A 150 ? ? -113.08 74.08 54 4 ASN A 152 ? ? 64.20 108.25 55 4 LYS A 154 ? ? -177.67 85.53 56 4 PHE A 156 ? ? -150.13 60.79 57 5 PRO A 94 ? ? -69.73 91.46 58 5 SER A 96 ? ? -159.34 70.26 59 5 ARG A 101 ? ? -163.78 91.18 60 5 THR A 110 ? ? 56.74 -179.25 61 5 SER A 113 ? ? -101.37 78.60 62 5 ASP A 123 ? ? -145.20 25.89 63 5 ASP A 125 ? ? 63.39 85.76 64 5 THR A 133 ? ? -161.56 105.47 65 5 CYS A 142 ? ? -101.38 -159.11 66 5 HIS A 150 ? ? -112.41 76.41 67 5 ASN A 152 ? ? 63.49 -169.83 68 5 LYS A 154 ? ? 65.07 112.75 69 5 ARG A 160 ? ? -109.95 -169.93 70 6 GLU A 99 ? ? -161.35 90.87 71 6 PHE A 106 ? ? -106.91 53.07 72 6 ALA A 114 ? ? -159.78 27.13 73 6 ASP A 123 ? ? -143.51 25.77 74 6 ASP A 125 ? ? 63.51 85.94 75 6 VAL A 131 ? ? -145.75 17.22 76 6 HIS A 150 ? ? -113.19 73.63 77 6 ASN A 152 ? ? 64.89 111.95 78 6 LYS A 153 ? ? -160.58 111.62 79 6 LYS A 154 ? ? -174.77 85.27 80 6 PHE A 156 ? ? -148.45 -70.01 81 6 THR A 157 ? ? 37.47 43.12 82 6 LEU A 161 ? ? -169.88 -169.94 83 7 THR A 112 ? ? -155.40 -51.24 84 7 SER A 113 ? ? 48.26 -94.49 85 7 ALA A 114 ? ? -149.07 25.70 86 7 ASP A 123 ? ? -141.73 26.40 87 7 ASP A 125 ? ? 60.27 85.48 88 7 CYS A 142 ? ? -102.71 -159.75 89 7 HIS A 150 ? ? -113.07 74.26 90 7 LYS A 153 ? ? -121.84 -77.33 91 7 PHE A 156 ? ? -162.29 67.49 92 7 THR A 157 ? ? -90.63 46.37 93 7 GLU A 163 ? ? 54.34 73.23 94 8 LYS A 88 ? ? 57.23 -174.95 95 8 SER A 90 ? ? -105.67 73.52 96 8 PRO A 94 ? ? -69.75 98.67 97 8 THR A 100 ? ? -132.27 -44.07 98 8 ARG A 104 ? ? -108.59 -61.59 99 8 PHE A 106 ? ? -161.47 -71.99 100 8 ASP A 107 ? ? 69.61 -75.43 101 8 ALA A 108 ? ? -174.61 -72.35 102 8 SER A 113 ? ? -63.97 99.39 103 8 ASP A 123 ? ? -142.97 25.24 104 8 ASP A 125 ? ? 63.53 86.29 105 8 CYS A 142 ? ? -101.64 -158.13 106 8 HIS A 150 ? ? -113.26 72.98 107 8 PRO A 151 ? ? -69.75 90.72 108 8 LYS A 154 ? ? 62.77 161.32 109 8 PHE A 156 ? ? -157.39 53.04 110 8 THR A 157 ? ? -94.48 37.98 111 9 SER A 92 ? ? -119.47 57.33 112 9 ALA A 114 ? ? 63.68 169.79 113 9 GLU A 115 ? ? -100.74 -68.03 114 9 ASP A 123 ? ? -145.36 26.02 115 9 ASP A 125 ? ? 62.53 85.72 116 9 CYS A 142 ? ? -100.11 -158.67 117 9 HIS A 150 ? ? -113.27 73.40 118 9 LYS A 154 ? ? 61.61 163.35 119 9 PHE A 156 ? ? 32.95 62.23 120 9 GLU A 163 ? ? 52.31 73.19 121 10 ALA A 89 ? ? -177.96 144.80 122 10 PRO A 94 ? ? -69.76 -176.39 123 10 ARG A 104 ? ? 62.36 173.53 124 10 ALA A 105 ? ? -166.55 -48.73 125 10 PHE A 106 ? ? 63.22 162.23 126 10 GLU A 115 ? ? -131.68 -68.08 127 10 ASP A 123 ? ? -141.04 26.19 128 10 ASP A 125 ? ? 63.35 85.71 129 10 CYS A 142 ? ? -101.52 -160.48 130 10 HIS A 150 ? ? -112.84 76.07 131 10 PRO A 151 ? ? -69.86 84.75 132 10 ASN A 152 ? ? -54.43 175.24 133 10 LYS A 153 ? ? -128.80 -79.39 134 10 LYS A 154 ? ? 177.13 104.33 135 10 PHE A 156 ? ? -139.15 -55.95 136 10 THR A 157 ? ? 37.32 43.36 137 11 GLU A 99 ? ? -112.72 77.54 138 11 THR A 100 ? ? -106.83 40.55 139 11 ARG A 101 ? ? -171.10 129.44 140 11 ALA A 108 ? ? 56.67 92.59 141 11 ALA A 114 ? ? 56.88 -178.30 142 11 GLU A 115 ? ? -129.48 -68.08 143 11 LYS A 116 ? ? 62.14 171.92 144 11 ASP A 123 ? ? -143.11 26.39 145 11 ASP A 125 ? ? 61.75 85.52 146 11 VAL A 131 ? ? -140.29 20.51 147 11 HIS A 150 ? ? -113.26 74.07 148 11 PRO A 151 ? ? -69.74 -170.01 149 11 ASN A 152 ? ? 64.67 155.60 150 11 LYS A 154 ? ? 66.41 137.62 151 11 PHE A 156 ? ? -135.93 -74.11 152 11 THR A 157 ? ? 178.05 -31.90 153 11 LEU A 161 ? ? -165.31 -169.82 154 12 SER A 90 ? ? -178.54 83.43 155 12 PRO A 97 ? ? -69.76 93.92 156 12 ASN A 109 ? ? -151.75 40.56 157 12 THR A 112 ? ? 51.46 -170.99 158 12 ALA A 114 ? ? -178.94 -33.83 159 12 GLU A 115 ? ? 71.58 -69.54 160 12 ASP A 123 ? ? -148.21 26.28 161 12 ASP A 125 ? ? 63.20 85.71 162 12 THR A 133 ? ? -161.01 104.33 163 12 CYS A 142 ? ? -101.61 -159.93 164 12 HIS A 150 ? ? -113.34 73.71 165 12 ASN A 152 ? ? 66.74 137.90 166 12 LYS A 153 ? ? -179.52 115.62 167 12 LYS A 154 ? ? -175.42 85.44 168 12 PHE A 156 ? ? -150.44 60.99 169 12 ARG A 160 ? ? -110.00 -169.32 170 13 SER A 96 ? ? -118.44 71.37 171 13 ALA A 108 ? ? -161.63 108.26 172 13 MET A 111 ? ? -102.94 45.28 173 13 THR A 112 ? ? -172.54 72.19 174 13 GLU A 115 ? ? 71.55 -69.45 175 13 VAL A 117 ? ? -68.37 97.18 176 13 ASP A 123 ? ? -147.49 26.58 177 13 ASP A 125 ? ? 60.59 85.65 178 13 CYS A 142 ? ? -101.82 -158.94 179 13 HIS A 150 ? ? -112.62 74.27 180 13 ASN A 152 ? ? 179.71 -174.09 181 13 LYS A 154 ? ? 62.92 160.87 182 13 PHE A 156 ? ? -160.88 43.54 # _pdbx_nmr_ensemble.entry_id 2FFW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 13 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FFW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.75 mM U-15N,13C protein; 50 mM Tris-HCl, 300 mM NaCl, 50 mM beta-mercaptoethanol, 5 mM ZnCl2, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '50 mM Tris-HCl, 300 mM NaCl, 50 mM beta-mercaptoethanol, 5 mM ZnCl2, 90% H2O, 10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 294 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '300 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCA 1 2 1 HNCACB 1 3 1 CBCACONH 1 4 1 3D_15N-separated_ROESY 1 5 1 3D_13C-separated_NOESY 1 6 1 HCCH-TOCSY 1 # _pdbx_nmr_details.entry_id 2FFW _pdbx_nmr_details.text 'Structure was determined using triple resonance data for backbone atom assignment and NOEs from 13C- and 15N-edited NOESY spectra' # _pdbx_nmr_refine.entry_id 2FFW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 2.1 'P Guntert' 1 processing NMRPipe ? 'Delagio, F' 2 collection Sparky sparky-mac10.2 Goddard 3 refinement CYANA 2.1 'P Guntert' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2FFW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #