data_2FHI # _entry.id 2FHI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FHI pdb_00002fhi 10.2210/pdb2fhi/pdb WWPDB D_1000178091 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FHI _pdbx_database_status.recvd_initial_deposition_date 1998-04-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pace, H.C.' 1 'Garrison, P.N.' 2 'Robinson, A.K.' 3 'Barnes, L.D.' 4 'Draganescu, A.' 5 'Rosler, A.' 6 'Blackburn, G.M.' 7 'Siprashvili, Z.' 8 'Croce, C.M.' 9 'Heubner, K.' 10 'Brenner, C.' 11 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Genetic, biochemical, and crystallographic characterization of Fhit-substrate complexes as the active signaling form of Fhit.' Proc.Natl.Acad.Sci.USA 95 5484 5489 1998 PNASA6 US 0027-8424 0040 ? 9576908 10.1073/pnas.95.10.5484 1 'Purification and Crystallization of Complexes Modeling the Active State of the Fragile Histidine Triad Protein' 'Protein Eng.' 10 1461 ? 1997 PRENE9 UK 0269-2139 0859 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pace, H.C.' 1 ? primary 'Garrison, P.N.' 2 ? primary 'Robinson, A.K.' 3 ? primary 'Barnes, L.D.' 4 ? primary 'Draganescu, A.' 5 ? primary 'Rosler, A.' 6 ? primary 'Blackburn, G.M.' 7 ? primary 'Siprashvili, Z.' 8 ? primary 'Croce, C.M.' 9 ? primary 'Huebner, K.' 10 ? primary 'Brenner, C.' 11 ? 1 'Brenner, C.' 12 ? 1 'Pace, H.C.' 13 ? 1 'Garrison, P.N.' 14 ? 1 'Robinson, A.K.' 15 ? 1 'Rosler, A.' 16 ? 1 'Liu, X.H.' 17 ? 1 'Blackburn, G.M.' 18 ? 1 'Croce, C.M.' 19 ? 1 'Huebner, K.' 20 ? 1 'Barnes, L.D.' 21 ? # _cell.entry_id 2FHI _cell.length_a 50.460 _cell.length_b 50.460 _cell.length_c 268.950 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2FHI _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FRAGILE HISTIDINE TRIAD PROTEIN' 16862.158 1 3.6.1.29 H96N ? ? 2 non-polymer syn 'P1-P2-METHYLENE-P3-THIO-DIADENOSINE TRIPHOSPHATE' 770.500 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FHIT # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF SMQDGPEAGQTVKHVNVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF SMQDGPEAGQTVKHVNVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PHE n 1 4 ARG n 1 5 PHE n 1 6 GLY n 1 7 GLN n 1 8 HIS n 1 9 LEU n 1 10 ILE n 1 11 LYS n 1 12 PRO n 1 13 SER n 1 14 VAL n 1 15 VAL n 1 16 PHE n 1 17 LEU n 1 18 LYS n 1 19 THR n 1 20 GLU n 1 21 LEU n 1 22 SER n 1 23 PHE n 1 24 ALA n 1 25 LEU n 1 26 VAL n 1 27 ASN n 1 28 ARG n 1 29 LYS n 1 30 PRO n 1 31 VAL n 1 32 VAL n 1 33 PRO n 1 34 GLY n 1 35 HIS n 1 36 VAL n 1 37 LEU n 1 38 VAL n 1 39 CYS n 1 40 PRO n 1 41 LEU n 1 42 ARG n 1 43 PRO n 1 44 VAL n 1 45 GLU n 1 46 ARG n 1 47 PHE n 1 48 HIS n 1 49 ASP n 1 50 LEU n 1 51 ARG n 1 52 PRO n 1 53 ASP n 1 54 GLU n 1 55 VAL n 1 56 ALA n 1 57 ASP n 1 58 LEU n 1 59 PHE n 1 60 GLN n 1 61 THR n 1 62 THR n 1 63 GLN n 1 64 ARG n 1 65 VAL n 1 66 GLY n 1 67 THR n 1 68 VAL n 1 69 VAL n 1 70 GLU n 1 71 LYS n 1 72 HIS n 1 73 PHE n 1 74 HIS n 1 75 GLY n 1 76 THR n 1 77 SER n 1 78 LEU n 1 79 THR n 1 80 PHE n 1 81 SER n 1 82 MET n 1 83 GLN n 1 84 ASP n 1 85 GLY n 1 86 PRO n 1 87 GLU n 1 88 ALA n 1 89 GLY n 1 90 GLN n 1 91 THR n 1 92 VAL n 1 93 LYS n 1 94 HIS n 1 95 VAL n 1 96 ASN n 1 97 VAL n 1 98 HIS n 1 99 VAL n 1 100 LEU n 1 101 PRO n 1 102 ARG n 1 103 LYS n 1 104 ALA n 1 105 GLY n 1 106 ASP n 1 107 PHE n 1 108 HIS n 1 109 ARG n 1 110 ASN n 1 111 ASP n 1 112 SER n 1 113 ILE n 1 114 TYR n 1 115 GLU n 1 116 GLU n 1 117 LEU n 1 118 GLN n 1 119 LYS n 1 120 HIS n 1 121 ASP n 1 122 LYS n 1 123 GLU n 1 124 ASP n 1 125 PHE n 1 126 PRO n 1 127 ALA n 1 128 SER n 1 129 TRP n 1 130 ARG n 1 131 SER n 1 132 GLU n 1 133 GLU n 1 134 GLU n 1 135 MET n 1 136 ALA n 1 137 ALA n 1 138 GLU n 1 139 ALA n 1 140 ALA n 1 141 ALA n 1 142 LEU n 1 143 ARG n 1 144 VAL n 1 145 TYR n 1 146 PHE n 1 147 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FHIT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM109/DE3/LACIQ _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PSGA02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHIT_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P49789 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF SMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FHI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49789 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2FHI _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 96 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P49789 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 96 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 96 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IB2 non-polymer . 'P1-P2-METHYLENE-P3-THIO-DIADENOSINE TRIPHOSPHATE' ADO-P-CH2-P-PS-ADO 'C21 H29 N10 O14 P3 S' 770.500 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FHI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.83 _exptl_crystal.density_percent_sol 58. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;FHIT H96N WAS COCRYSTALLIZED WITH 2.9 MOLAR EQUIVALENTS OF IB2 BY VAPOR DIFFUSION WITH 2 M AMMONIUM SULFATE, 4% PEG 400, AND 0.1M NA HEPES PH 7.5. ; # _diffrn.id 1 _diffrn.ambient_temp 98 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ADSC _diffrn_detector.pdbx_collection_date 1997-12-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9188 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_wavelength 0.9188 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2FHI _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 21.8 _reflns.d_resolution_high 2.0 _reflns.number_obs 12563 _reflns.number_all ? _reflns.percent_possible_obs 88. _reflns.pdbx_Rmerge_I_obs 0.0970000 _reflns.pdbx_Rsym_value 0.0970000 _reflns.pdbx_netI_over_sigmaI 3.0 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 80. _reflns_shell.Rmerge_I_obs 0.2670000 _reflns_shell.pdbx_Rsym_value 0.2670000 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2FHI _refine.ls_number_reflns_obs 5718 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 84.0 _refine.ls_R_factor_obs 0.2410000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2410000 _refine.ls_R_factor_R_free 0.2780000 _refine.ls_R_factor_R_free_error 0.013 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.0 _refine.ls_number_reflns_R_free 428 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 32.8 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1FIT' _refine.pdbx_method_to_determine_struct REFINEMENT _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 991 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1072 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 6.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 26.0 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.04 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.71 _refine_ls_shell.number_reflns_R_work 553 _refine_ls_shell.R_factor_R_work 0.3560000 _refine_ls_shell.percent_reflns_obs 83.4 _refine_ls_shell.R_factor_R_free 0.4360000 _refine_ls_shell.R_factor_R_free_error 0.061 _refine_ls_shell.percent_reflns_R_free 6.76 _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARHCSDX.PRO TOPH19.PEP 'X-RAY DIFFRACTION' 3 WATER.PARAM WATER2.TOPH 'X-RAY DIFFRACTION' 4 IB2.PAR IB2.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 2FHI _struct.title 'SUBSTRATE ANALOG (IB2) COMPLEX WITH THE HIS 96 ASN SUBSTITUTION OF THE FRAGILE HISTIDINE TRIAD PROTEIN, FHIT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FHI _struct_keywords.pdbx_keywords 'NUCLEOTIDE-BINDING PROTEIN' _struct_keywords.text 'NUCLEOTIDE-BINDING PROTEIN, CANCER, DIADENOSINE TRIPHOSPHATE HYDROLASE, ACTIVE SITE SUBSTITUTION, HISTIDINE TRIAD, TUMOR SUPPRESSOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 12 ? VAL A 14 ? PRO A 12 VAL A 14 5 ? 3 HELX_P HELX_P2 2 PHE A 47 ? ASP A 49 ? PHE A 47 ASP A 49 5 ? 3 HELX_P HELX_P3 3 PRO A 52 ? HIS A 72 ? PRO A 52 HIS A 72 1 ? 21 HELX_P HELX_P4 4 PRO A 86 ? ALA A 88 ? PRO A 86 ALA A 88 5 ? 3 HELX_P HELX_P5 5 GLU A 132 ? VAL A 144 ? GLU A 132 VAL A 144 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 3 ? PHE A 5 ? PHE A 3 PHE A 5 A 2 HIS A 8 ? ILE A 10 ? HIS A 8 ILE A 10 B 1 SER A 77 ? SER A 81 ? SER A 77 SER A 81 B 2 VAL A 97 ? ARG A 102 ? VAL A 97 ARG A 102 B 3 VAL A 36 ? PRO A 40 ? VAL A 36 PRO A 40 B 4 SER A 22 ? VAL A 26 ? SER A 22 VAL A 26 B 5 VAL A 15 ? LYS A 18 ? VAL A 15 LYS A 18 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 3 ? O PHE A 3 N ILE A 10 ? N ILE A 10 B 1 2 O SER A 77 ? O SER A 77 N ARG A 102 ? N ARG A 102 B 2 3 O VAL A 97 ? O VAL A 97 N VAL A 38 ? N VAL A 38 B 3 4 O LEU A 37 ? O LEU A 37 N LEU A 25 ? N LEU A 25 B 4 5 O ALA A 24 ? O ALA A 24 N LEU A 17 ? N LEU A 17 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details HIT Unknown ? ? ? ? 3 ;THE HISTIDINE TRIAD SITE CONTAINS THE MOTIF COMMON TO PROTEINS IN THE HIT SUPERFAMILY OF NUCLEOTIDE-BINDING PROTEINS. HIS 96 IS THE PRINCIPAL ACTIVE SITE RESIDUE AND SUBSTITUTION WITH ASN REDUCES KCAT (10E6)-FOLD WITH LITTLE EFFECT ON KM. HIS 98 IS PROPOSED TO H-BOND TO THE SCISSILE BRIDGING OXYGEN OF DINUCLEOTIDE SUBSTRATES. ; AC1 Software A IB2 301 ? 14 'BINDING SITE FOR RESIDUE IB2 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 HIT 3 HIS A 94 ? HIS A 94 . ? 1_555 ? 2 HIT 3 ASN A 96 ? ASN A 96 . ? 1_555 ? 3 HIT 3 HIS A 98 ? HIS A 98 . ? 1_555 ? 4 AC1 14 PHE A 5 ? PHE A 5 . ? 1_555 ? 5 AC1 14 VAL A 26 ? VAL A 26 . ? 1_555 ? 6 AC1 14 ASN A 27 ? ASN A 27 . ? 1_555 ? 7 AC1 14 LEU A 37 ? LEU A 37 . ? 1_555 ? 8 AC1 14 THR A 79 ? THR A 79 . ? 1_555 ? 9 AC1 14 PHE A 80 ? PHE A 80 . ? 1_555 ? 10 AC1 14 SER A 81 ? SER A 81 . ? 1_555 ? 11 AC1 14 GLN A 83 ? GLN A 83 . ? 1_555 ? 12 AC1 14 GLY A 89 ? GLY A 89 . ? 1_555 ? 13 AC1 14 THR A 91 ? THR A 91 . ? 1_555 ? 14 AC1 14 VAL A 92 ? VAL A 92 . ? 1_555 ? 15 AC1 14 ASN A 96 ? ASN A 96 . ? 1_555 ? 16 AC1 14 HIS A 98 ? HIS A 98 . ? 1_555 ? 17 AC1 14 LEU A 100 ? LEU A 100 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FHI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FHI _atom_sites.fract_transf_matrix[1][1] 0.019818 _atom_sites.fract_transf_matrix[1][2] 0.011442 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022883 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003718 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 PHE 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 ASN 110 110 ? ? ? A . n A 1 111 ASP 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 ILE 113 113 ? ? ? A . n A 1 114 TYR 114 114 ? ? ? A . n A 1 115 GLU 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 LEU 117 117 ? ? ? A . n A 1 118 GLN 118 118 ? ? ? A . n A 1 119 LYS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 ASP 124 124 ? ? ? A . n A 1 125 PHE 125 125 ? ? ? A . n A 1 126 PRO 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 SER 128 128 ? ? ? A . n A 1 129 TRP 129 129 129 TRP TRP A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 GLN 147 147 147 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IB2 1 301 301 IB2 IB2 A . C 3 HOH 1 201 201 HOH HOH A . C 3 HOH 2 202 202 HOH HOH A . C 3 HOH 3 203 203 HOH HOH A . C 3 HOH 4 204 204 HOH HOH A . C 3 HOH 5 205 205 HOH HOH A . C 3 HOH 6 206 206 HOH HOH A . C 3 HOH 7 207 207 HOH HOH A . C 3 HOH 8 208 208 HOH HOH A . C 3 HOH 9 209 209 HOH HOH A . C 3 HOH 10 210 210 HOH HOH A . C 3 HOH 11 211 211 HOH HOH A . C 3 HOH 12 212 212 HOH HOH A . C 3 HOH 13 213 213 HOH HOH A . C 3 HOH 14 214 214 HOH HOH A . C 3 HOH 15 215 215 HOH HOH A . C 3 HOH 16 216 216 HOH HOH A . C 3 HOH 17 217 217 HOH HOH A . C 3 HOH 18 218 218 HOH HOH A . C 3 HOH 19 219 219 HOH HOH A . C 3 HOH 20 220 220 HOH HOH A . C 3 HOH 21 221 221 HOH HOH A . C 3 HOH 22 222 222 HOH HOH A . C 3 HOH 23 223 223 HOH HOH A . C 3 HOH 24 224 224 HOH HOH A . C 3 HOH 25 225 225 HOH HOH A . C 3 HOH 26 226 226 HOH HOH A . C 3 HOH 27 227 227 HOH HOH A . C 3 HOH 28 228 228 HOH HOH A . C 3 HOH 29 229 229 HOH HOH A . C 3 HOH 30 230 230 HOH HOH A . C 3 HOH 31 231 231 HOH HOH A . C 3 HOH 32 232 232 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4460 ? 1 MORE -24 ? 1 'SSA (A^2)' 11200 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.8250000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site 5 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 MOSFLM 'data reduction' . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 X-PLOR phasing . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 57 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 19 ? ? -105.22 -157.36 2 1 SER A 81 ? ? -170.38 140.21 3 1 ASN A 96 ? ? -166.97 115.57 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PHE 107 ? A PHE 107 3 1 Y 1 A HIS 108 ? A HIS 108 4 1 Y 1 A ARG 109 ? A ARG 109 5 1 Y 1 A ASN 110 ? A ASN 110 6 1 Y 1 A ASP 111 ? A ASP 111 7 1 Y 1 A SER 112 ? A SER 112 8 1 Y 1 A ILE 113 ? A ILE 113 9 1 Y 1 A TYR 114 ? A TYR 114 10 1 Y 1 A GLU 115 ? A GLU 115 11 1 Y 1 A GLU 116 ? A GLU 116 12 1 Y 1 A LEU 117 ? A LEU 117 13 1 Y 1 A GLN 118 ? A GLN 118 14 1 Y 1 A LYS 119 ? A LYS 119 15 1 Y 1 A HIS 120 ? A HIS 120 16 1 Y 1 A ASP 121 ? A ASP 121 17 1 Y 1 A LYS 122 ? A LYS 122 18 1 Y 1 A GLU 123 ? A GLU 123 19 1 Y 1 A ASP 124 ? A ASP 124 20 1 Y 1 A PHE 125 ? A PHE 125 21 1 Y 1 A PRO 126 ? A PRO 126 22 1 Y 1 A ALA 127 ? A ALA 127 23 1 Y 1 A SER 128 ? A SER 128 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'P1-P2-METHYLENE-P3-THIO-DIADENOSINE TRIPHOSPHATE' IB2 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FIT _pdbx_initial_refinement_model.details 'PDB ENTRY 1FIT' #