data_2FRY # _entry.id 2FRY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FRY pdb_00002fry 10.2210/pdb2fry/pdb RCSB RCSB036238 ? ? WWPDB D_1000036238 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2FRW _pdbx_database_related.details 'the second SH3 domain of the same protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FRY _pdbx_database_status.recvd_initial_deposition_date 2006-01-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Liu, J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins' _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 7171 _citation.page_last 7184 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16752908 _citation.pdbx_database_id_DOI 10.1021/bi060091y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, J.' 1 ? primary 'Li, M.' 2 ? primary 'Ran, X.' 3 ? primary 'Fan, J.S.' 4 ? primary 'Song, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoplasmic protein NCK2' _entity.formula_weight 6973.820 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment SH3_3 _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NCK adaptor protein 2, SH2/SH3 adaptor protein NCK-beta, Nck-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS _entity_poly.pdbx_seq_one_letter_code_can GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 VAL n 1 5 VAL n 1 6 GLN n 1 7 THR n 1 8 LEU n 1 9 TYR n 1 10 PRO n 1 11 PHE n 1 12 SER n 1 13 SER n 1 14 VAL n 1 15 THR n 1 16 GLU n 1 17 GLU n 1 18 GLU n 1 19 LEU n 1 20 ASN n 1 21 PHE n 1 22 GLU n 1 23 LYS n 1 24 GLY n 1 25 GLU n 1 26 THR n 1 27 MET n 1 28 GLU n 1 29 VAL n 1 30 ILE n 1 31 GLU n 1 32 LYS n 1 33 PRO n 1 34 GLU n 1 35 ASN n 1 36 ASP n 1 37 PRO n 1 38 GLU n 1 39 TRP n 1 40 TRP n 1 41 LYS n 1 42 CYS n 1 43 LYS n 1 44 ASN n 1 45 ALA n 1 46 ARG n 1 47 GLY n 1 48 GLN n 1 49 VAL n 1 50 GLY n 1 51 LEU n 1 52 VAL n 1 53 PRO n 1 54 LYS n 1 55 ASN n 1 56 TYR n 1 57 VAL n 1 58 VAL n 1 59 VAL n 1 60 LEU n 1 61 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32-a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCK2_HUMAN _struct_ref.pdbx_db_accession O43639 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 198 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FRY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43639 _struct_ref_seq.db_align_beg 198 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FRY GLY A 1 ? UNP O43639 ? ? 'cloning artifact' 1 1 1 2FRY SER A 2 ? UNP O43639 ? ? 'cloning artifact' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM phosphate buffer, 90% H2O, 10% D2O, 0.01% NaN3, 10mM DTT' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2FRY _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details 'the structures are based on a total of 812 restraints, 722 are NOE-derived distance constraints, 90 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2FRY _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 2FRY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FRY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.1 Brunger 1 processing NMRPipe 2004 'Frank Delaglio' 2 # _exptl.entry_id 2FRY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2FRY _struct.title 'Solution structure of the third SH3 domain of human NCK2 adaptor protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FRY _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'SH3, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 53 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 55 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 53 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 55 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 26 ? MET A 27 ? THR A 26 MET A 27 A 2 VAL A 5 ? THR A 7 ? VAL A 5 THR A 7 A 3 VAL A 57 ? VAL A 59 ? VAL A 57 VAL A 59 B 1 TRP A 40 ? LYS A 43 ? TRP A 40 LYS A 43 B 2 VAL A 49 ? VAL A 52 ? VAL A 49 VAL A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MET A 27 ? O MET A 27 N VAL A 5 ? N VAL A 5 A 2 3 N GLN A 6 ? N GLN A 6 O VAL A 58 ? O VAL A 58 B 1 2 N TRP A 40 ? N TRP A 40 O VAL A 52 ? O VAL A 52 # _database_PDB_matrix.entry_id 2FRY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FRY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-20 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A VAL 5 ? ? O A MET 27 ? ? 1.55 2 2 H A VAL 5 ? ? O A MET 27 ? ? 1.58 3 3 HE1 A TRP 40 ? ? H A LYS 54 ? ? 1.35 4 3 H A VAL 5 ? ? O A MET 27 ? ? 1.56 5 4 H A VAL 5 ? ? O A MET 27 ? ? 1.55 6 4 O A GLN 6 ? ? H A VAL 58 ? ? 1.59 7 5 H A VAL 5 ? ? O A MET 27 ? ? 1.56 8 7 H A VAL 5 ? ? O A MET 27 ? ? 1.57 9 9 H A VAL 5 ? ? O A MET 27 ? ? 1.50 10 9 O A LYS 54 ? ? H A VAL 57 ? ? 1.52 11 10 H A VAL 5 ? ? O A MET 27 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? -131.71 -34.66 2 1 VAL A 14 ? ? -132.54 -55.31 3 1 THR A 15 ? ? -46.17 158.40 4 1 GLU A 25 ? ? -94.91 -147.13 5 1 PRO A 37 ? ? -44.43 177.14 6 2 PRO A 10 ? ? -46.10 175.42 7 2 VAL A 14 ? ? -132.47 -47.88 8 2 THR A 15 ? ? -55.38 172.50 9 2 GLU A 17 ? ? -92.73 32.77 10 2 GLU A 22 ? ? -69.40 99.33 11 2 GLU A 38 ? ? -114.55 -75.46 12 2 PRO A 53 ? ? -60.43 87.36 13 3 PRO A 10 ? ? -44.11 151.72 14 3 VAL A 14 ? ? -173.06 89.58 15 3 GLU A 22 ? ? -63.85 -156.03 16 3 ILE A 30 ? ? -79.31 -77.11 17 3 GLU A 38 ? ? -121.75 -77.09 18 3 LYS A 54 ? ? -45.24 -11.48 19 4 LEU A 8 ? ? -131.09 -35.81 20 4 GLU A 22 ? ? -63.61 -157.39 21 4 PRO A 37 ? ? -42.17 -75.40 22 4 GLU A 38 ? ? -175.41 17.89 23 5 LEU A 8 ? ? -131.76 -40.02 24 5 PRO A 10 ? ? -54.59 -176.27 25 5 VAL A 14 ? ? -144.86 -31.36 26 5 GLU A 17 ? ? -98.63 32.68 27 5 GLU A 22 ? ? -64.94 98.32 28 5 PRO A 37 ? ? -61.75 79.36 29 5 GLU A 38 ? ? -119.30 -83.71 30 5 PRO A 53 ? ? -60.79 82.14 31 6 LEU A 8 ? ? -131.31 -44.08 32 6 VAL A 14 ? ? -135.88 -45.16 33 6 GLU A 18 ? ? -54.54 -171.67 34 6 ILE A 30 ? ? -81.23 -81.99 35 6 PRO A 33 ? ? -66.90 62.36 36 6 GLU A 38 ? ? -152.84 -98.69 37 7 LEU A 8 ? ? -131.50 -41.24 38 7 PRO A 10 ? ? -54.45 -166.12 39 7 VAL A 14 ? ? -145.15 55.21 40 7 GLU A 18 ? ? -124.85 -168.64 41 7 LEU A 19 ? ? -178.85 148.94 42 7 ILE A 30 ? ? -86.53 -78.37 43 7 GLU A 38 ? ? -102.76 -88.07 44 7 PRO A 53 ? ? -60.55 88.13 45 8 LEU A 8 ? ? -131.51 -40.66 46 8 VAL A 14 ? ? -173.34 -42.69 47 8 PRO A 33 ? ? -59.02 92.70 48 8 GLU A 38 ? ? -98.53 -94.36 49 9 PRO A 10 ? ? -46.68 173.38 50 9 VAL A 14 ? ? -167.57 -41.36 51 9 GLU A 17 ? ? -96.07 33.19 52 9 GLU A 22 ? ? -64.06 -156.68 53 9 ILE A 30 ? ? -90.79 -67.99 54 9 GLU A 38 ? ? -103.33 -83.79 55 10 PRO A 10 ? ? -54.56 -165.90 56 10 ILE A 30 ? ? -81.59 -84.46 57 10 PRO A 37 ? ? -40.41 -76.26 58 10 GLU A 38 ? ? -161.18 14.43 59 10 PRO A 53 ? ? -62.89 92.96 #