data_2FT7 # _entry.id 2FT7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2FT7 RCSB RCSB036282 WWPDB D_1000036282 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2FT6 ;Crystal structure of Cu(II)azurin with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPM" ; unspecified PDB 2FT8 ;Crystal structure of Cu(I)azurin, pH8, with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPM" ; unspecified PDB 2FTA ;Crystal structure of Cu(II)azurin with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPFM" ; unspecified # _pdbx_database_status.entry_id 2FT7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-01-24 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Banfield, M.J.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.' Proc.Natl.Acad.Sci.Usa 103 7258 7263 2006 PNASA6 US 0027-8424 0040 ? 16651527 10.1073/pnas.0600774103 1 ;Crystal structure analysis of oxidized Pseudomonas aeruginosa azurin at pH 5.5 and pH 9.0. A pH-induced conformational transition involves a peptide bond flip ; J.Mol.Biol. 221 765 772 1991 JMOBAK UK 0022-2836 0070 ? 1942029 '10.1016/0022-2836(91)80173-R' 2 'Loop-contraction mutagenesis of type 1 copper sites' J.Am.Chem.Soc. 126 15711 15719 2004 JACSAT US 0002-7863 0004 ? 15571393 10.1021/ja047295r 3 ;Crystal structure analysis and refinement at 2.15 A resolution of amicyanin, a type I blue copper protein, from Thiobacillus versutus ; J.Mol.Biol. 236 1196 1211 1994 JMOBAK UK 0022-2836 0070 ? 8120896 '10.1016/0022-2836(94)90021-3' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Li, C.' 1 primary 'Yanagisawa, S.' 2 primary 'Martins, B.M.' 3 primary 'Messerschmidt, A.' 4 primary 'Banfield, M.J.' 5 primary 'Dennison, C.' 6 1 'Nar, H.' 7 1 'Messerschmidt, A.' 8 1 'Huber, R.' 9 1 'van de Kamp, M.' 10 1 'Canters, G.W.' 11 2 'Yanagisawa, S.' 12 2 'Dennison, C.' 13 3 'Romero, A.' 14 3 'Nar, H.' 15 3 'Huber, R.' 16 3 'Messerschmidt, A.' 17 3 'Kalverda, A.P.' 18 3 'Canters, G.W.' 19 3 'Durley, R.' 20 3 'Mathews, F.S.' 21 # _cell.entry_id 2FT7 _cell.length_a 51.957 _cell.length_b 51.957 _cell.length_c 75.410 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FT7 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Azurin 13583.375 1 ? ? ? ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 164 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 CYS n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 ILE n 1 8 GLN n 1 9 GLY n 1 10 ASN n 1 11 ASP n 1 12 GLN n 1 13 MET n 1 14 GLN n 1 15 PHE n 1 16 ASN n 1 17 THR n 1 18 ASN n 1 19 ALA n 1 20 ILE n 1 21 THR n 1 22 VAL n 1 23 ASP n 1 24 LYS n 1 25 SER n 1 26 CYS n 1 27 LYS n 1 28 GLN n 1 29 PHE n 1 30 THR n 1 31 VAL n 1 32 ASN n 1 33 LEU n 1 34 SER n 1 35 HIS n 1 36 PRO n 1 37 GLY n 1 38 ASN n 1 39 LEU n 1 40 PRO n 1 41 LYS n 1 42 ASN n 1 43 VAL n 1 44 MET n 1 45 GLY n 1 46 HIS n 1 47 ASN n 1 48 TRP n 1 49 VAL n 1 50 LEU n 1 51 SER n 1 52 THR n 1 53 ALA n 1 54 ALA n 1 55 ASP n 1 56 MET n 1 57 GLN n 1 58 GLY n 1 59 VAL n 1 60 VAL n 1 61 THR n 1 62 ASP n 1 63 GLY n 1 64 MET n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 LEU n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 TYR n 1 73 LEU n 1 74 LYS n 1 75 PRO n 1 76 ASP n 1 77 ASP n 1 78 SER n 1 79 ARG n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 HIS n 1 84 THR n 1 85 LYS n 1 86 LEU n 1 87 ILE n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 ASP n 1 94 SER n 1 95 VAL n 1 96 THR n 1 97 PHE n 1 98 ASP n 1 99 VAL n 1 100 SER n 1 101 LYS n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 GLU n 1 107 GLN n 1 108 TYR n 1 109 MET n 1 110 PHE n 1 111 PHE n 1 112 CYS n 1 113 THR n 1 114 PRO n 1 115 HIS n 1 116 PRO n 1 117 MET n 1 118 LYS n 1 119 GLY n 1 120 THR n 1 121 LEU n 1 122 THR n 1 123 LEU n 1 124 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene azu _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM101 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name Trk99a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUR_PSEAE _struct_ref.pdbx_db_accession P00282 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK ; _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FT7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00282 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FT7 ? A ? ? UNP P00282 PHE 134 'SEE REMARK 999' ? 1 1 2FT7 ? A ? ? UNP P00282 GLY 136 'SEE REMARK 999' ? 2 1 2FT7 ? A ? ? UNP P00282 SER 138 'SEE REMARK 999' ? 3 1 2FT7 ? A ? ? UNP P00282 ALA 139 'SEE REMARK 999' ? 4 1 2FT7 ? A ? ? UNP P00282 LEU 140 'SEE REMARK 999' ? 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FT7 _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 34.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1MM MES, 20% PEG6000, 0.2M LiCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2005-10-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Double SI(III) crystal' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.075 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX10.1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.075 _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX10.1 # _reflns.entry_id 2FT7 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.4 _reflns.d_resolution_low 42.8 _reflns.number_all 29159 _reflns.number_obs 29159 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value 0.06 _reflns.pdbx_netI_over_sigmaI 24.9 _reflns.B_iso_Wilson_estimate 14.9 _reflns.pdbx_redundancy 9.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.4 _reflns_shell.d_res_low 1.48 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.324 _reflns_shell.meanI_over_sigI_obs 6.7 _reflns_shell.pdbx_Rsym_value 0.324 _reflns_shell.pdbx_redundancy 8.6 _reflns_shell.number_unique_all 2999 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.ls_d_res_high 1.400 _refine.ls_d_res_low 42.800 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.320 _refine.ls_number_reflns_obs 20853 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS BUT NOT PRESENT IN OUTPUT FILE' _refine.ls_R_factor_all 0.141 _refine.ls_R_factor_R_work 0.139 _refine.ls_R_factor_R_free 0.178 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 1045 _refine.B_iso_mean 13.252 _refine.aniso_B[1][1] -0.480 _refine.aniso_B[2][2] -0.480 _refine.aniso_B[3][3] 0.950 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.975 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.pdbx_overall_ESU_R 0.068 _refine.pdbx_overall_ESU_R_Free 0.061 _refine.overall_SU_ML 0.037 _refine.overall_SU_B 1.977 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.entry_id 2FT7 _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 20853 _refine.ls_R_factor_obs 0.141 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'Direct refinement using refined AZAMI-F Cu(II) structure' _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 965 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 164 _refine_hist.number_atoms_total 1131 _refine_hist.d_res_high 1.400 _refine_hist.d_res_low 42.800 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 994 0.018 0.021 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 871 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1368 1.707 1.950 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2051 0.876 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 141 6.566 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42 38.869 26.429 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 169 10.663 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 1 20.181 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 160 0.114 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1142 0.009 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 178 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 195 0.244 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 882 0.189 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 494 0.175 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 572 0.090 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 91 0.185 0.200 ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 1 0.017 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 10 0.313 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 34 0.288 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 19 0.191 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 682 2.182 1.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 262 1.187 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1047 2.849 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 383 3.828 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 312 4.815 4.500 ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2034 1.750 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_free 166 11.519 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded 1836 6.973 3.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.400 _refine_ls_shell.d_res_low 1.436 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 1427 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.148 _refine_ls_shell.R_factor_R_free 0.173 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1497 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2FT7 _struct.title ;Structure of Cu(I)azurin at pH 6, with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPM" ; _struct.pdbx_descriptor Azurin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FT7 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'Blue copper-binding protein, greek-key beta-barrel, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is monomeric (as found in the asymmetric unit)' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 40 ? GLY A 45 ? PRO A 40 GLY A 45 1 ? 6 HELX_P HELX_P2 2 ASP A 55 ? GLY A 67 ? ASP A 55 GLY A 67 1 ? 13 HELX_P HELX_P3 3 LEU A 68 ? ASP A 71 ? LEU A 68 ASP A 71 5 ? 4 HELX_P HELX_P4 4 SER A 100 ? LEU A 102 ? SER A 100 LEU A 102 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 3 A CYS 26 1_555 ? ? ? ? ? ? ? 2.068 ? metalc1 metalc ? ? B CU1 . CU A ? ? 1_555 A HIS 46 ND1 ? ? A CU1 200 A HIS 46 1_555 ? ? ? ? ? ? ? 2.012 ? metalc2 metalc ? ? B CU1 . CU B ? ? 1_555 A HIS 46 ND1 ? ? A CU1 200 A HIS 46 1_555 ? ? ? ? ? ? ? 2.099 ? metalc3 metalc ? ? B CU1 . CU A ? ? 1_555 A CYS 112 SG ? ? A CU1 200 A CYS 112 1_555 ? ? ? ? ? ? ? 2.219 ? metalc4 metalc ? ? B CU1 . CU B ? ? 1_555 A CYS 112 SG ? ? A CU1 200 A CYS 112 1_555 ? ? ? ? ? ? ? 2.093 ? metalc5 metalc ? ? B CU1 . CU A ? ? 1_555 A MET 117 SD ? ? A CU1 200 A MET 117 1_555 ? ? ? ? ? ? ? 2.567 ? metalc6 metalc ? ? B CU1 . CU B ? ? 1_555 A HIS 115 ND1 B ? A CU1 200 A HIS 115 1_555 ? ? ? ? ? ? ? 2.201 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 4 ? GLN A 8 ? SER A 4 GLN A 8 A 2 GLN A 28 ? SER A 34 ? GLN A 28 SER A 34 A 3 LYS A 92 ? ASP A 98 ? LYS A 92 ASP A 98 B 1 ALA A 19 ? VAL A 22 ? ALA A 19 VAL A 22 B 2 LYS A 118 ? LEU A 123 ? LYS A 118 LEU A 123 B 3 TYR A 108 ? PHE A 111 ? TYR A 108 PHE A 111 B 4 VAL A 49 ? THR A 52 ? VAL A 49 THR A 52 B 5 ALA A 82 ? HIS A 83 ? ALA A 82 HIS A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 5 ? N VAL A 5 O ASN A 32 ? O ASN A 32 A 2 3 N VAL A 31 ? N VAL A 31 O VAL A 95 ? O VAL A 95 B 1 2 N ILE A 20 ? N ILE A 20 O THR A 120 ? O THR A 120 B 2 3 O GLY A 119 ? O GLY A 119 N PHE A 110 ? N PHE A 110 B 3 4 O MET A 109 ? O MET A 109 N SER A 51 ? N SER A 51 B 4 5 N LEU A 50 ? N LEU A 50 O ALA A 82 ? O ALA A 82 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 45 ? GLY A 45 . ? 1_555 ? 2 AC1 5 HIS A 46 ? HIS A 46 . ? 1_555 ? 3 AC1 5 CYS A 112 ? CYS A 112 . ? 1_555 ? 4 AC1 5 HIS A 115 ? HIS A 115 . ? 1_555 ? 5 AC1 5 MET A 117 ? MET A 117 . ? 1_555 ? # _atom_sites.entry_id 2FT7 _atom_sites.fract_transf_matrix[1][1] 0.019247 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019247 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013261 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU1 1 200 200 CU1 CU1 A . C 3 HOH 1 201 1 HOH HOH A . C 3 HOH 2 202 2 HOH HOH A . C 3 HOH 3 203 3 HOH HOH A . C 3 HOH 4 204 4 HOH HOH A . C 3 HOH 5 205 5 HOH HOH A . C 3 HOH 6 206 6 HOH HOH A . C 3 HOH 7 207 7 HOH HOH A . C 3 HOH 8 208 8 HOH HOH A . C 3 HOH 9 209 9 HOH HOH A . C 3 HOH 10 210 10 HOH HOH A . C 3 HOH 11 211 11 HOH HOH A . C 3 HOH 12 212 12 HOH HOH A . C 3 HOH 13 213 13 HOH HOH A . C 3 HOH 14 214 14 HOH HOH A . C 3 HOH 15 215 15 HOH HOH A . C 3 HOH 16 216 16 HOH HOH A . C 3 HOH 17 217 17 HOH HOH A . C 3 HOH 18 218 18 HOH HOH A . C 3 HOH 19 219 19 HOH HOH A . C 3 HOH 20 220 20 HOH HOH A . C 3 HOH 21 221 21 HOH HOH A . C 3 HOH 22 222 22 HOH HOH A . C 3 HOH 23 223 23 HOH HOH A . C 3 HOH 24 224 24 HOH HOH A . C 3 HOH 25 225 25 HOH HOH A . C 3 HOH 26 226 26 HOH HOH A . C 3 HOH 27 227 27 HOH HOH A . C 3 HOH 28 228 28 HOH HOH A . C 3 HOH 29 229 29 HOH HOH A . C 3 HOH 30 230 30 HOH HOH A . C 3 HOH 31 231 31 HOH HOH A . C 3 HOH 32 232 32 HOH HOH A . C 3 HOH 33 233 33 HOH HOH A . C 3 HOH 34 234 34 HOH HOH A . C 3 HOH 35 235 35 HOH HOH A . C 3 HOH 36 236 36 HOH HOH A . C 3 HOH 37 237 37 HOH HOH A . C 3 HOH 38 238 38 HOH HOH A . C 3 HOH 39 239 39 HOH HOH A . C 3 HOH 40 240 40 HOH HOH A . C 3 HOH 41 241 41 HOH HOH A . C 3 HOH 42 242 42 HOH HOH A . C 3 HOH 43 243 43 HOH HOH A . C 3 HOH 44 244 44 HOH HOH A . C 3 HOH 45 245 45 HOH HOH A . C 3 HOH 46 246 46 HOH HOH A . C 3 HOH 47 247 47 HOH HOH A . C 3 HOH 48 248 48 HOH HOH A . C 3 HOH 49 249 49 HOH HOH A . C 3 HOH 50 250 50 HOH HOH A . C 3 HOH 51 251 51 HOH HOH A . C 3 HOH 52 252 52 HOH HOH A . C 3 HOH 53 253 53 HOH HOH A . C 3 HOH 54 254 54 HOH HOH A . C 3 HOH 55 255 55 HOH HOH A . C 3 HOH 56 256 56 HOH HOH A . C 3 HOH 57 257 57 HOH HOH A . C 3 HOH 58 258 58 HOH HOH A . C 3 HOH 59 259 59 HOH HOH A . C 3 HOH 60 260 60 HOH HOH A . C 3 HOH 61 261 61 HOH HOH A . C 3 HOH 62 262 62 HOH HOH A . C 3 HOH 63 263 63 HOH HOH A . C 3 HOH 64 264 64 HOH HOH A . C 3 HOH 65 265 65 HOH HOH A . C 3 HOH 66 266 66 HOH HOH A . C 3 HOH 67 267 67 HOH HOH A . C 3 HOH 68 268 68 HOH HOH A . C 3 HOH 69 269 69 HOH HOH A . C 3 HOH 70 270 70 HOH HOH A . C 3 HOH 71 271 71 HOH HOH A . C 3 HOH 72 272 72 HOH HOH A . C 3 HOH 73 273 73 HOH HOH A . C 3 HOH 74 274 74 HOH HOH A . C 3 HOH 75 275 75 HOH HOH A . C 3 HOH 76 276 76 HOH HOH A . C 3 HOH 77 277 77 HOH HOH A . C 3 HOH 78 278 78 HOH HOH A . C 3 HOH 79 279 79 HOH HOH A . C 3 HOH 80 280 80 HOH HOH A . C 3 HOH 81 281 81 HOH HOH A . C 3 HOH 82 282 82 HOH HOH A . C 3 HOH 83 283 83 HOH HOH A . C 3 HOH 84 284 84 HOH HOH A . C 3 HOH 85 285 85 HOH HOH A . C 3 HOH 86 286 86 HOH HOH A . C 3 HOH 87 287 87 HOH HOH A . C 3 HOH 88 288 88 HOH HOH A . C 3 HOH 89 289 89 HOH HOH A . C 3 HOH 90 290 90 HOH HOH A . C 3 HOH 91 291 91 HOH HOH A . C 3 HOH 92 292 92 HOH HOH A . C 3 HOH 93 293 93 HOH HOH A . C 3 HOH 94 294 94 HOH HOH A . C 3 HOH 95 295 95 HOH HOH A . C 3 HOH 96 296 96 HOH HOH A . C 3 HOH 97 297 97 HOH HOH A . C 3 HOH 98 298 98 HOH HOH A . C 3 HOH 99 299 99 HOH HOH A . C 3 HOH 100 300 100 HOH HOH A . C 3 HOH 101 301 101 HOH HOH A . C 3 HOH 102 302 102 HOH HOH A . C 3 HOH 103 303 103 HOH HOH A . C 3 HOH 104 304 105 HOH HOH A . C 3 HOH 105 305 106 HOH HOH A . C 3 HOH 106 306 107 HOH HOH A . C 3 HOH 107 307 108 HOH HOH A . C 3 HOH 108 308 109 HOH HOH A . C 3 HOH 109 309 110 HOH HOH A . C 3 HOH 110 310 111 HOH HOH A . C 3 HOH 111 311 112 HOH HOH A . C 3 HOH 112 312 113 HOH HOH A . C 3 HOH 113 313 114 HOH HOH A . C 3 HOH 114 314 115 HOH HOH A . C 3 HOH 115 315 116 HOH HOH A . C 3 HOH 116 316 117 HOH HOH A . C 3 HOH 117 317 118 HOH HOH A . C 3 HOH 118 318 119 HOH HOH A . C 3 HOH 119 319 120 HOH HOH A . C 3 HOH 120 320 121 HOH HOH A . C 3 HOH 121 321 122 HOH HOH A . C 3 HOH 122 322 123 HOH HOH A . C 3 HOH 123 323 124 HOH HOH A . C 3 HOH 124 324 125 HOH HOH A . C 3 HOH 125 325 126 HOH HOH A . C 3 HOH 126 326 127 HOH HOH A . C 3 HOH 127 327 128 HOH HOH A . C 3 HOH 128 328 130 HOH HOH A . C 3 HOH 129 329 131 HOH HOH A . C 3 HOH 130 330 132 HOH HOH A . C 3 HOH 131 331 133 HOH HOH A . C 3 HOH 132 332 134 HOH HOH A . C 3 HOH 133 333 135 HOH HOH A . C 3 HOH 134 334 136 HOH HOH A . C 3 HOH 135 335 137 HOH HOH A . C 3 HOH 136 336 138 HOH HOH A . C 3 HOH 137 337 140 HOH HOH A . C 3 HOH 138 338 141 HOH HOH A . C 3 HOH 139 339 142 HOH HOH A . C 3 HOH 140 340 143 HOH HOH A . C 3 HOH 141 341 145 HOH HOH A . C 3 HOH 142 342 146 HOH HOH A . C 3 HOH 143 343 147 HOH HOH A . C 3 HOH 144 344 148 HOH HOH A . C 3 HOH 145 345 151 HOH HOH A . C 3 HOH 146 346 152 HOH HOH A . C 3 HOH 147 347 153 HOH HOH A . C 3 HOH 148 348 155 HOH HOH A . C 3 HOH 149 349 156 HOH HOH A . C 3 HOH 150 350 160 HOH HOH A . C 3 HOH 151 351 162 HOH HOH A . C 3 HOH 152 352 163 HOH HOH A . C 3 HOH 153 353 164 HOH HOH A . C 3 HOH 154 354 165 HOH HOH A . C 3 HOH 155 355 167 HOH HOH A . C 3 HOH 156 356 168 HOH HOH A . C 3 HOH 157 357 170 HOH HOH A . C 3 HOH 158 358 171 HOH HOH A . C 3 HOH 159 359 172 HOH HOH A . C 3 HOH 160 360 173 HOH HOH A . C 3 HOH 161 361 174 HOH HOH A . C 3 HOH 162 362 176 HOH HOH A . C 3 HOH 163 363 177 HOH HOH A . C 3 HOH 164 364 178 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU A B CU1 . ? A CU1 200 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 135.4 ? 2 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU A B CU1 . ? A CU1 200 ? 1_555 SD ? A MET 117 ? A MET 117 ? 1_555 96.4 ? 3 SG ? A CYS 112 ? A CYS 112 ? 1_555 CU A B CU1 . ? A CU1 200 ? 1_555 SD ? A MET 117 ? A MET 117 ? 1_555 124.9 ? 4 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU B B CU1 . ? A CU1 200 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 138.1 ? 5 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU B B CU1 . ? A CU1 200 ? 1_555 ND1 B A HIS 115 ? A HIS 115 ? 1_555 95.6 ? 6 SG ? A CYS 112 ? A CYS 112 ? 1_555 CU B B CU1 . ? A CU1 200 ? 1_555 ND1 B A HIS 115 ? A HIS 115 ? 1_555 126.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-04-11 2 'Structure model' 1 1 2008-04-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 3 PDB_EXTRACT 1.701 'Nov. 1, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 5 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;Amino acid sequence CTFPGHSALM, involving residues 132 to 141 in the amino acid database was replaced with the sequence CTPHPM in the deposition ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD A LYS 70 ? ? O A HOH 280 ? ? 1.92 2 1 O A HOH 318 ? ? O A HOH 364 ? ? 2.08 3 1 O A HOH 258 ? ? O A HOH 363 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 299 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 320 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_555 _pdbx_validate_symm_contact.dist 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 44 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -141.06 _pdbx_validate_torsion.psi 48.21 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 18 ? CG ? A ASN 18 CG 2 1 Y 1 A ASN 18 ? OD1 ? A ASN 18 OD1 3 1 Y 1 A ASN 18 ? ND2 ? A ASN 18 ND2 4 1 Y 1 A LYS 24 ? CG ? A LYS 24 CG 5 1 Y 1 A LYS 24 ? CD ? A LYS 24 CD 6 1 Y 1 A LYS 24 ? CE ? A LYS 24 CE 7 1 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 8 1 Y 1 A LYS 27 ? CG ? A LYS 27 CG 9 1 Y 1 A LYS 27 ? CD ? A LYS 27 CD 10 1 Y 1 A LYS 27 ? CE ? A LYS 27 CE 11 1 Y 1 A LYS 27 ? NZ ? A LYS 27 NZ 12 1 Y 1 A LYS 70 ? CE ? A LYS 70 CE 13 1 Y 1 A LYS 70 ? NZ ? A LYS 70 NZ 14 1 Y 1 A LYS 92 ? NZ ? A LYS 92 NZ 15 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ 16 1 Y 1 A LYS 124 ? CD ? A LYS 124 CD 17 1 Y 1 A LYS 124 ? CE ? A LYS 124 CE 18 1 Y 1 A LYS 124 ? NZ ? A LYS 124 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A GLU 2 ? A GLU 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (I) ION' CU1 3 water HOH #