data_2FUU # _entry.id 2FUU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FUU pdb_00002fuu 10.2210/pdb2fuu/pdb RCSB RCSB036338 ? ? WWPDB D_1000036338 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2FUI 'NMR solution structure of PHD finger fragment of human BPTF in free state' unspecified PDB 2F6J 'Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the H3(1-15)K4me3 bound state' unspecified PDB 2FSA 'Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the H3(1-15)K4me3 bound state' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FUU _pdbx_database_status.recvd_initial_deposition_date 2006-01-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ilin, S.' 1 'Patel, D.J.' 2 # _citation.id primary _citation.title 'Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.' _citation.journal_abbrev Nature _citation.journal_volume 442 _citation.page_first 91 _citation.page_last 95 _citation.year 2006 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16728978 _citation.pdbx_database_id_DOI 10.1038/nature04802 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Ilin, S.' 2 ? primary 'Wang, W.' 3 ? primary 'Duncan, E.M.' 4 ? primary 'Wysocka, J.' 5 ? primary 'Allis, C.D.' 6 ? primary 'Patel, D.J.' 7 ? # _cell.entry_id 2FUU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2FUU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'bromodomain PHD finger transcription factor' 7050.871 1 ? ? 'PHD FINGER DOMAIN (RESIDUES 2583-2639)' ? 2 polymer syn 'Histone H3' 1607.877 1 ? 'K4(M3L)' 'H3(1-15)K4me3' ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA A ? 2 'polypeptide(L)' no yes 'ART(M3L)QTARKSTGGKA' ARTKQTARKSTGGKA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ASP n 1 7 THR n 1 8 LYS n 1 9 LEU n 1 10 TYR n 1 11 CYS n 1 12 ILE n 1 13 CYS n 1 14 LYS n 1 15 THR n 1 16 PRO n 1 17 TYR n 1 18 ASP n 1 19 GLU n 1 20 SER n 1 21 LYS n 1 22 PHE n 1 23 TYR n 1 24 ILE n 1 25 GLY n 1 26 CYS n 1 27 ASP n 1 28 ARG n 1 29 CYS n 1 30 GLN n 1 31 ASN n 1 32 TRP n 1 33 TYR n 1 34 HIS n 1 35 GLY n 1 36 ARG n 1 37 CYS n 1 38 VAL n 1 39 GLY n 1 40 ILE n 1 41 LEU n 1 42 GLN n 1 43 SER n 1 44 GLU n 1 45 ALA n 1 46 GLU n 1 47 LEU n 1 48 ILE n 1 49 ASP n 1 50 GLU n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 PRO n 1 55 GLN n 1 56 CYS n 1 57 GLN n 1 58 SER n 1 59 THR n 1 60 GLU n 1 61 ASP n 1 62 ALA n 2 1 ALA n 2 2 ARG n 2 3 THR n 2 4 M3L n 2 5 GLN n 2 6 THR n 2 7 ALA n 2 8 ARG n 2 9 LYS n 2 10 SER n 2 11 THR n 2 12 GLY n 2 13 GLY n 2 14 LYS n 2 15 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosseta 2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGex6p _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Synthetic. The sequence ARTKQTARKSTGGKA occurs naturally in humans on Histone 3' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 GB AAP22284 31322942 1 DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA 2583 ? 2 UNP H3_ZYGBA P61836 2 ARTKQTARKSTGGKA 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2FUU A 6 ? 62 ? 31322942 2583 ? 2639 ? 6 62 2 2 2FUU B 1 ? 15 ? P61836 1 ? 15 ? 1 15 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FUU GLY A 1 ? GB 31322942 ? ? 'cloning artifact' 1 1 1 2FUU PRO A 2 ? GB 31322942 ? ? 'cloning artifact' 2 2 1 2FUU LEU A 3 ? GB 31322942 ? ? 'cloning artifact' 3 3 1 2FUU GLY A 4 ? GB 31322942 ? ? 'cloning artifact' 4 4 1 2FUU SER A 5 ? GB 31322942 ? ? 'cloning artifact' 5 5 2 2FUU M3L B 4 ? UNP P61836 LYS 4 'modified residue' 4 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 2 3 1 '3D filter-edit 15N-separated NOESY' 2 4 1 '3D filter-edit 13C-separated NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.64 mM PHD finger U-15N,13C; 3.0 mM H3(1-15)K4me3; 20 mM Phosphate buffer pH 7.5, 50 mM KCl, 5 mM DTT' '90% H2O/10% D2O' 2 '0.62 mM PHD finger U-15N, 3.0 mM H3(1-15)K4me3; 20 mM Phosphate buffer pH 7.5, 50 mM KCl, 5 mM DTT' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 UNITYPLUS Varian 600 ? 2 AVANCE Bruker 800 ? 3 AVANCE Bruker 900 ? # _pdbx_nmr_refine.entry_id 2FUU _pdbx_nmr_refine.method 'The structure was solved using a torsion angle simulated annealing protocol' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2FUU _pdbx_nmr_details.text ;The structure was determined using various triple-resonance NMR experiments plus filter edit experiments to determine the structure of the peptide. ; # _pdbx_nmr_ensemble.entry_id 2FUU _pdbx_nmr_ensemble.conformers_calculated_total_number 85 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FUU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection TopSpin 1.5 Bruker 1 collection VNMR 1.6c Varian 2 'data analysis' CARA 1.5.3 'Rochus Keller' 3 'structure solution' X-PLOR 2.13 'G. Marius Clore' 4 processing NMRPipe ? 'F. Delaglio' 5 refinement X-PLOR 2.13 'G. Marius Clore' 6 # _exptl.entry_id 2FUU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2FUU _struct.title 'NMR solution structure of the PHD domain from the human BPTF in complex with H3(1-15)K4me3 peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FUU _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'BPTF, NURF, PHD DOMAIN, HISTONE RECOGNITION, H3K4ME3, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 36 ? GLY A 39 ? ARG A 36 GLY A 39 5 ? 4 HELX_P HELX_P2 2 GLN A 42 ? GLU A 46 ? GLN A 42 GLU A 46 5 ? 5 HELX_P HELX_P3 3 CYS A 53 ? ASP A 61 ? CYS A 53 ASP A 61 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 11 A CYS 37 1_555 ? ? ? ? ? ? ? 0.943 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 13 A CYS 37 1_555 ? ? ? ? ? ? ? 0.919 ? ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 26 A CYS 29 1_555 ? ? ? ? ? ? ? 0.587 ? ? disulf4 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 29 A CYS 53 1_555 ? ? ? ? ? ? ? 0.693 ? ? disulf5 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 53 A CYS 56 1_555 ? ? ? ? ? ? ? 0.752 ? ? covale1 covale both ? B THR 3 C ? ? ? 1_555 B M3L 4 N ? ? B THR 3 B M3L 4 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? B M3L 4 C ? ? ? 1_555 B GLN 5 N ? ? B M3L 4 B GLN 5 1_555 ? ? ? ? ? ? ? 1.332 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 23 ? GLY A 25 ? TYR A 23 GLY A 25 A 2 TRP A 32 ? HIS A 34 ? TRP A 32 HIS A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 7 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 202 ? 4 'BINDING SITE FOR RESIDUE ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 CYS A 26 ? CYS A 26 . ? 1_555 ? 2 AC1 7 ASP A 27 ? ASP A 27 . ? 1_555 ? 3 AC1 7 ARG A 28 ? ARG A 28 . ? 1_555 ? 4 AC1 7 CYS A 29 ? CYS A 29 . ? 1_555 ? 5 AC1 7 VAL A 52 ? VAL A 52 . ? 1_555 ? 6 AC1 7 CYS A 53 ? CYS A 53 . ? 1_555 ? 7 AC1 7 CYS A 56 ? CYS A 56 . ? 1_555 ? 8 AC2 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 9 AC2 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 10 AC2 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 11 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FUU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FUU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ALA 62 62 62 ALA ALA A . n B 2 1 ALA 1 1 1 ALA ALA B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 THR 3 3 3 THR THR B . n B 2 4 M3L 4 4 4 M3L M3L B . n B 2 5 GLN 5 5 5 GLN GLN B . n B 2 6 THR 6 6 6 THR THR B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 ARG 8 8 8 ARG ARG B . n B 2 9 LYS 9 9 9 LYS LYS B . n B 2 10 SER 10 10 10 SER SER B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n B 2 13 GLY 13 13 13 GLY GLY B . n B 2 14 LYS 14 14 14 LYS LYS B . n B 2 15 ALA 15 15 15 ALA ALA B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 201 201 ZN ZN A . D 3 ZN 1 202 202 ZN ZN A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id M3L _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id M3L _pdbx_struct_mod_residue.auth_seq_id 4 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-11 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.64 2 1 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.75 3 1 SG A CYS 11 ? ? SG A CYS 13 ? ? 1.00 4 1 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.15 5 1 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.24 6 1 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.28 7 1 O A ASP 18 ? ? H A LYS 21 ? ? 1.32 8 1 HD11 A ILE 48 ? ? H A ASP 49 ? ? 1.34 9 1 H A CYS 26 ? ? O A ASN 31 ? ? 1.37 10 1 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 11 1 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.41 12 1 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.45 13 1 O A GLU 44 ? ? HB A ILE 48 ? ? 1.48 14 1 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.50 15 1 O A ASP 27 ? ? HH22 B ARG 2 ? ? 1.55 16 1 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 17 1 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.56 18 1 O A ARG 36 ? ? H A GLY 39 ? ? 1.58 19 1 O A CYS 26 ? ? H A GLN 30 ? ? 1.60 20 1 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.04 21 1 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.16 22 1 OD1 A ASN 31 ? ? OH A TYR 33 ? ? 2.18 23 2 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.66 24 2 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.80 25 2 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.88 26 2 SG A CYS 26 ? ? SG A CYS 56 ? ? 0.89 27 2 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 28 2 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.25 29 2 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.36 30 2 O A ASP 18 ? ? H A LYS 21 ? ? 1.38 31 2 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.43 32 2 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.44 33 2 O A GLY 35 ? ? H A ILE 40 ? ? 1.53 34 2 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.54 35 2 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.63 36 2 CB A CYS 26 ? ? SG A CYS 29 ? ? 2.17 37 3 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.65 38 3 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.74 39 3 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.90 40 3 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.16 41 3 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 42 3 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.29 43 3 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 44 3 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.40 45 3 O A ASP 18 ? ? H A LYS 21 ? ? 1.41 46 3 O A CYS 11 ? ? H A LYS 14 ? ? 1.42 47 3 H A CYS 26 ? ? O A ASN 31 ? ? 1.46 48 3 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 49 3 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 50 3 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 51 3 O A CYS 26 ? ? H A GLN 30 ? ? 1.57 52 3 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.03 53 3 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.17 54 3 OD1 A ASN 31 ? ? OH A TYR 33 ? ? 2.17 55 4 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.65 56 4 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.75 57 4 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.86 58 4 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.15 59 4 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 60 4 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.24 61 4 H A CYS 26 ? ? O A ASN 31 ? ? 1.34 62 4 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.38 63 4 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 64 4 O A ASP 18 ? ? H A LYS 21 ? ? 1.44 65 4 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.50 66 4 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.55 67 4 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.56 68 4 O A CYS 26 ? ? H A GLN 30 ? ? 1.56 69 4 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.57 70 4 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.04 71 4 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.15 72 5 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.73 73 5 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.84 74 5 SG A CYS 26 ? ? SG A CYS 56 ? ? 0.89 75 5 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.93 76 5 HZ1 A LYS 21 ? ? HH11 A ARG 36 ? ? 1.11 77 5 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 78 5 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.25 79 5 H A LEU 41 ? ? OE1 A GLU 44 ? ? 1.29 80 5 HB2 A CYS 11 ? ? H A HIS 34 ? ? 1.34 81 5 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.36 82 5 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 83 5 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.45 84 5 O A GLY 35 ? ? H A ILE 40 ? ? 1.45 85 5 O A CYS 11 ? ? H A LYS 14 ? ? 1.48 86 5 O A CYS 26 ? ? HH22 B ARG 2 ? ? 1.49 87 5 O A ASP 18 ? ? H A LYS 21 ? ? 1.55 88 5 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.55 89 5 H A CYS 26 ? ? O A ASN 31 ? ? 1.59 90 5 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.62 91 5 CB A CYS 26 ? ? SG A CYS 29 ? ? 2.15 92 5 N A LEU 41 ? ? OE1 A GLU 44 ? ? 2.18 93 6 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.68 94 6 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.80 95 6 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.88 96 6 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.15 97 6 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.20 98 6 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 99 6 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.31 100 6 HG1 A THR 15 ? ? HE2 A HIS 34 ? ? 1.32 101 6 O A ASP 18 ? ? H A LYS 21 ? ? 1.38 102 6 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.41 103 6 HD22 A ASN 31 ? ? OH A TYR 33 ? ? 1.48 104 6 O A GLY 4 ? ? HG A SER 5 ? ? 1.50 105 6 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.50 106 6 O A CYS 11 ? ? H A LYS 14 ? ? 1.52 107 6 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.55 108 6 HD13 A LEU 47 ? ? N A ILE 48 ? ? 1.59 109 6 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.65 110 6 CB A CYS 29 ? ? SG A CYS 53 ? ? 2.05 111 6 CB A CYS 26 ? ? SG A CYS 53 ? ? 2.09 112 6 CB A CYS 29 ? ? SG A CYS 56 ? ? 2.17 113 7 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.66 114 7 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.85 115 7 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.90 116 7 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.11 117 7 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.20 118 7 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.24 119 7 HE1 A TYR 17 ? ? HE1 A TYR 23 ? ? 1.29 120 7 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.31 121 7 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 122 7 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.47 123 7 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.49 124 7 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.55 125 7 O A CYS 11 ? ? H A LYS 14 ? ? 1.56 126 7 OD1 A ASP 6 ? ? H A THR 7 ? ? 1.59 127 7 HD22 A ASN 31 ? ? OH A TYR 33 ? ? 1.59 128 7 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.66 129 7 CB A CYS 29 ? ? SG A CYS 53 ? ? 2.10 130 7 CB A CYS 26 ? ? SG A CYS 53 ? ? 2.11 131 7 CB A CYS 29 ? ? SG A CYS 56 ? ? 2.17 132 8 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.68 133 8 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.76 134 8 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.93 135 8 HG1 A THR 15 ? ? HE2 A HIS 34 ? ? 1.10 136 8 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.18 137 8 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 138 8 H A LEU 41 ? ? OE2 A GLU 44 ? ? 1.26 139 8 H A LEU 41 ? ? HE2 A GLU 44 ? ? 1.28 140 8 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.28 141 8 O A CYS 11 ? ? H A LYS 14 ? ? 1.37 142 8 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 143 8 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.40 144 8 O A ASP 18 ? ? H A LYS 21 ? ? 1.46 145 8 H A CYS 26 ? ? O A ASN 31 ? ? 1.48 146 8 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 147 8 O A CYS 26 ? ? HH12 B ARG 2 ? ? 1.54 148 8 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 149 8 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 150 8 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.02 151 8 N A LEU 41 ? ? OE2 A GLU 44 ? ? 2.16 152 8 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.16 153 9 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.68 154 9 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.76 155 9 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.81 156 9 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.17 157 9 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 158 9 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 159 9 H A CYS 26 ? ? O A ASN 31 ? ? 1.35 160 9 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 161 9 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.43 162 9 O A CYS 56 ? ? H A GLU 60 ? ? 1.45 163 9 O A ASP 18 ? ? H A LYS 21 ? ? 1.46 164 9 O A CYS 11 ? ? H A LYS 14 ? ? 1.46 165 9 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 166 9 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.54 167 9 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 168 9 O A GLY 35 ? ? H A ILE 40 ? ? 1.57 169 9 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.02 170 9 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.18 171 10 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.67 172 10 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.73 173 10 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.98 174 10 HG1 A THR 15 ? ? HE1 A HIS 34 ? ? 1.11 175 10 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.17 176 10 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 177 10 HA A ASP 49 ? ? H2 B ALA 1 ? ? 1.28 178 10 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.29 179 10 H A CYS 26 ? ? O A ASN 31 ? ? 1.30 180 10 HD11 A ILE 48 ? ? H A ASP 49 ? ? 1.34 181 10 O A GLY 35 ? ? H A ILE 40 ? ? 1.37 182 10 O A ASP 18 ? ? H A LYS 21 ? ? 1.38 183 10 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 184 10 O A CYS 11 ? ? H A LYS 14 ? ? 1.39 185 10 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.41 186 10 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 187 10 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 188 10 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 189 10 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.03 190 10 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.17 191 11 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.68 192 11 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.78 193 11 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.80 194 11 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.20 195 11 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 196 11 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 197 11 HE2 A GLU 46 ? ? HG B SER 10 ? ? 1.31 198 11 O A ASP 18 ? ? H A LYS 21 ? ? 1.31 199 11 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 200 11 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 201 11 H A CYS 26 ? ? O A ASN 31 ? ? 1.44 202 11 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.52 203 11 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.53 204 11 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 205 11 O A CYS 26 ? ? H A GLN 30 ? ? 1.57 206 11 HD22 A ASN 31 ? ? OH A TYR 33 ? ? 1.57 207 11 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.01 208 11 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.16 209 12 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.68 210 12 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.77 211 12 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.92 212 12 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.20 213 12 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 214 12 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.29 215 12 HH A TYR 17 ? ? H B ALA 7 ? ? 1.30 216 12 O A ASP 18 ? ? H A LYS 21 ? ? 1.35 217 12 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 218 12 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.40 219 12 H A CYS 26 ? ? O A ASN 31 ? ? 1.47 220 12 O A CYS 26 ? ? HH22 B ARG 2 ? ? 1.51 221 12 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.52 222 12 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.54 223 12 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 224 12 O A CYS 11 ? ? H A LYS 14 ? ? 1.56 225 12 SG A CYS 26 ? ? CB A CYS 53 ? ? 1.97 226 12 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.15 227 13 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.71 228 13 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.74 229 13 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.89 230 13 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.14 231 13 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.24 232 13 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.25 233 13 O A CYS 11 ? ? H A LYS 14 ? ? 1.38 234 13 O A ASP 18 ? ? H A LYS 21 ? ? 1.38 235 13 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 236 13 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.43 237 13 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.50 238 13 H A CYS 26 ? ? O A ASN 31 ? ? 1.53 239 13 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 240 13 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 241 13 O A CYS 56 ? ? H A THR 59 ? ? 1.56 242 13 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.00 243 13 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.11 244 14 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.65 245 14 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.70 246 14 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.76 247 14 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.08 248 14 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.24 249 14 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.25 250 14 HB2 A TYR 10 ? ? H A CYS 11 ? ? 1.32 251 14 O A CYS 11 ? ? H A LYS 14 ? ? 1.36 252 14 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 253 14 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.44 254 14 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 255 14 O A ASP 18 ? ? H A LYS 21 ? ? 1.51 256 14 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.52 257 14 H A CYS 26 ? ? O A ASN 31 ? ? 1.54 258 14 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 259 14 O A ARG 36 ? ? H A GLY 39 ? ? 1.56 260 14 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.00 261 14 OD1 A ASN 31 ? ? OH A TYR 33 ? ? 2.17 262 14 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.19 263 15 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.68 264 15 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.76 265 15 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.91 266 15 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.19 267 15 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 268 15 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.29 269 15 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 270 15 O A CYS 11 ? ? H A LYS 14 ? ? 1.40 271 15 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.40 272 15 H A CYS 26 ? ? O A ASN 31 ? ? 1.45 273 15 O A ASP 18 ? ? H A LYS 21 ? ? 1.46 274 15 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 275 15 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 276 15 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 277 15 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.01 278 15 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.17 279 16 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.72 280 16 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.77 281 16 SG A CYS 26 ? ? SG A CYS 56 ? ? 0.90 282 16 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.94 283 16 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 284 16 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.25 285 16 HD12 A ILE 48 ? ? HG1 B THR 3 ? ? 1.30 286 16 O A ASP 18 ? ? H A LYS 21 ? ? 1.33 287 16 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.36 288 16 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 289 16 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.44 290 16 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.54 291 16 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.55 292 16 H A CYS 26 ? ? O A ASN 31 ? ? 1.56 293 16 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.62 294 16 CB A CYS 26 ? ? SG A CYS 29 ? ? 2.15 295 17 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.69 296 17 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.74 297 17 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.77 298 17 H A LEU 41 ? ? HE2 A GLU 44 ? ? 1.01 299 17 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.17 300 17 H A LEU 41 ? ? OE2 A GLU 44 ? ? 1.21 301 17 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.22 302 17 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.24 303 17 O A ASP 18 ? ? H A LYS 21 ? ? 1.31 304 17 HG1 B THR 6 ? ? H B ALA 7 ? ? 1.34 305 17 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.37 306 17 H A CYS 26 ? ? O A ASN 31 ? ? 1.38 307 17 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.38 308 17 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.43 309 17 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 310 17 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.54 311 17 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 312 17 O A CYS 11 ? ? H A LYS 14 ? ? 1.59 313 17 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.03 314 17 N A LEU 41 ? ? OE2 A GLU 44 ? ? 2.06 315 17 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.17 316 18 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.67 317 18 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.73 318 18 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.98 319 18 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.14 320 18 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 321 18 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.28 322 18 HG1 A THR 15 ? ? HE1 A HIS 34 ? ? 1.34 323 18 HD12 A ILE 48 ? ? HG1 B THR 3 ? ? 1.35 324 18 O A GLY 35 ? ? H A ILE 40 ? ? 1.37 325 18 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 326 18 O A CYS 11 ? ? H A LYS 14 ? ? 1.39 327 18 O A ASP 18 ? ? H A LYS 21 ? ? 1.40 328 18 H A CYS 26 ? ? O A ASN 31 ? ? 1.40 329 18 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.41 330 18 HH21 A ARG 28 ? ? O A GLU 60 ? ? 1.43 331 18 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.46 332 18 O A CYS 26 ? ? H A GLN 30 ? ? 1.50 333 18 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 334 18 OE2 A GLU 19 ? ? HG1 B THR 6 ? ? 1.52 335 18 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 336 18 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 337 18 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.02 338 18 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.19 339 19 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.66 340 19 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.77 341 19 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.78 342 19 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.16 343 19 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.23 344 19 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 345 19 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.35 346 19 O A ASP 18 ? ? H A LYS 21 ? ? 1.37 347 19 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.40 348 19 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.42 349 19 H A LEU 41 ? ? OE2 A GLU 44 ? ? 1.43 350 19 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.51 351 19 O A CYS 11 ? ? H A LYS 14 ? ? 1.51 352 19 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.54 353 19 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.54 354 19 O A GLN 57 ? ? H A ASP 61 ? ? 1.58 355 19 H A CYS 26 ? ? O A ASN 31 ? ? 1.59 356 19 O A GLY 35 ? ? H A ILE 40 ? ? 1.60 357 19 SG A CYS 26 ? ? CB A CYS 53 ? ? 1.88 358 20 SG A CYS 26 ? ? SG A CYS 53 ? ? 0.67 359 20 SG A CYS 29 ? ? SG A CYS 56 ? ? 0.78 360 20 SG A CYS 11 ? ? SG A CYS 13 ? ? 0.93 361 20 HH21 A ARG 28 ? ? HG1 A THR 59 ? ? 1.11 362 20 SG A CYS 26 ? ? SG A CYS 56 ? ? 1.17 363 20 O B SER 10 ? ? H B GLY 13 ? ? 1.19 364 20 SG A CYS 56 ? ? ZN A ZN 201 ? ? 1.23 365 20 SG A CYS 37 ? ? ZN A ZN 202 ? ? 1.29 366 20 O A CYS 11 ? ? H A LYS 14 ? ? 1.35 367 20 SG A CYS 53 ? ? ZN A ZN 201 ? ? 1.39 368 20 SG A CYS 13 ? ? ZN A ZN 202 ? ? 1.40 369 20 H A CYS 26 ? ? O A ASN 31 ? ? 1.43 370 20 O A ARG 28 ? ? HE21 A GLN 30 ? ? 1.44 371 20 O B GLY 12 ? ? H B LYS 14 ? ? 1.46 372 20 SG A CYS 29 ? ? ZN A ZN 201 ? ? 1.52 373 20 SG A CYS 26 ? ? ZN A ZN 201 ? ? 1.55 374 20 O A CYS 26 ? ? HH21 B ARG 2 ? ? 1.55 375 20 O A ASP 27 ? ? HH22 B ARG 2 ? ? 1.56 376 20 SG A CYS 11 ? ? ZN A ZN 202 ? ? 1.56 377 20 O A GLY 35 ? ? H A ILE 40 ? ? 1.58 378 20 SG A CYS 26 ? ? CB A CYS 53 ? ? 2.02 379 20 SG A CYS 26 ? ? CB A CYS 29 ? ? 2.16 380 20 O B SER 10 ? ? N B GLY 13 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 10 ? ? -67.33 -109.68 2 1 CYS A 11 ? ? -36.39 134.21 3 1 ILE A 12 ? ? -59.91 -7.39 4 1 LYS A 14 ? ? 42.45 72.39 5 1 GLU A 19 ? ? -55.15 7.44 6 1 GLU A 44 ? ? -44.20 -19.76 7 1 LEU A 47 ? ? -66.74 12.49 8 1 ASP A 49 ? ? -169.19 27.78 9 1 GLU A 50 ? ? -161.50 14.76 10 1 ASP A 61 ? ? 31.00 41.82 11 1 ALA B 7 ? ? -150.10 37.10 12 1 THR B 11 ? ? -97.60 -70.27 13 2 LEU A 3 ? ? -122.06 -113.72 14 2 ASP A 6 ? ? -156.39 -14.10 15 2 TYR A 10 ? ? -53.05 -124.09 16 2 CYS A 11 ? ? -33.14 126.52 17 2 ILE A 12 ? ? -52.79 -6.91 18 2 LYS A 14 ? ? 50.68 70.97 19 2 PRO A 16 ? ? -48.75 -174.82 20 2 GLU A 19 ? ? -57.70 8.19 21 2 GLN A 30 ? ? 30.68 34.93 22 2 ASP A 49 ? ? -161.35 12.76 23 2 GLU A 50 ? ? -158.28 41.12 24 2 GLU A 60 ? ? -38.81 103.11 25 2 ARG B 2 ? ? -95.47 48.87 26 2 ALA B 7 ? ? 34.06 63.24 27 2 THR B 11 ? ? 57.56 -2.70 28 3 SER A 5 ? ? -151.93 -118.27 29 3 TYR A 10 ? ? -114.86 -93.92 30 3 CYS A 11 ? ? -36.24 134.92 31 3 ILE A 12 ? ? -51.10 -7.15 32 3 LYS A 14 ? ? 83.31 78.89 33 3 GLU A 19 ? ? -59.60 5.52 34 3 CYS A 26 ? ? -48.42 108.89 35 3 ASP A 49 ? ? -160.97 17.73 36 3 GLU A 50 ? ? -162.28 35.29 37 3 GLU A 60 ? ? 42.16 -164.61 38 3 ARG B 2 ? ? -88.67 33.51 39 3 THR B 11 ? ? 83.27 164.29 40 4 TYR A 10 ? ? -67.93 -108.36 41 4 CYS A 11 ? ? -35.63 131.28 42 4 ILE A 12 ? ? -47.78 -7.41 43 4 LYS A 14 ? ? 45.73 78.79 44 4 GLU A 19 ? ? -57.03 7.16 45 4 ASP A 49 ? ? -161.47 20.21 46 4 GLU A 50 ? ? -166.16 35.04 47 4 ARG B 8 ? ? -143.03 16.72 48 4 LYS B 9 ? ? 37.81 31.19 49 4 SER B 10 ? ? -145.81 -50.21 50 5 TYR A 10 ? ? -89.72 -110.60 51 5 CYS A 11 ? ? -37.09 132.68 52 5 ILE A 12 ? ? -46.15 -6.28 53 5 LYS A 14 ? ? 84.28 78.42 54 5 GLU A 19 ? ? -63.18 1.53 55 5 GLN A 30 ? ? 33.21 33.91 56 5 GLU A 44 ? ? -42.97 -19.40 57 5 ASP A 49 ? ? -161.10 8.54 58 5 GLU A 50 ? ? -149.69 36.15 59 5 GLU A 60 ? ? 58.09 132.90 60 5 ALA B 7 ? ? 57.40 134.11 61 6 SER A 5 ? ? 174.87 92.01 62 6 TYR A 10 ? ? -86.34 -110.11 63 6 CYS A 11 ? ? -37.93 132.45 64 6 ILE A 12 ? ? -47.79 -6.33 65 6 LYS A 14 ? ? 85.95 78.78 66 6 GLU A 19 ? ? -55.99 4.85 67 6 ASP A 27 ? ? -39.21 -39.40 68 6 GLN A 30 ? ? 37.31 16.10 69 6 GLU A 44 ? ? -42.10 -19.15 70 6 ASP A 49 ? ? -160.81 10.46 71 6 GLU A 50 ? ? -151.42 35.27 72 6 GLU A 60 ? ? 43.25 -150.64 73 6 ARG B 2 ? ? -86.04 43.21 74 6 M3L B 4 ? ? -114.23 77.65 75 6 SER B 10 ? ? 60.41 65.80 76 7 SER A 5 ? ? 38.59 96.50 77 7 TYR A 10 ? ? -116.30 -99.58 78 7 CYS A 11 ? ? -37.26 137.92 79 7 ILE A 12 ? ? -46.91 -6.86 80 7 LYS A 14 ? ? 89.33 80.26 81 7 GLN A 30 ? ? 30.67 23.70 82 7 GLU A 44 ? ? -42.39 -19.07 83 7 ASP A 49 ? ? -154.07 -18.63 84 7 ARG B 2 ? ? 39.53 26.23 85 7 ALA B 7 ? ? 78.44 165.98 86 7 THR B 11 ? ? 38.50 -151.76 87 8 LEU A 3 ? ? -3.13 -74.46 88 8 ASP A 6 ? ? 30.51 46.82 89 8 TYR A 10 ? ? -75.47 -99.16 90 8 CYS A 11 ? ? -35.50 136.16 91 8 ILE A 12 ? ? -53.34 -7.13 92 8 LYS A 14 ? ? 77.76 79.13 93 8 GLU A 19 ? ? -57.55 4.50 94 8 GLU A 44 ? ? -43.27 -18.84 95 8 ASP A 49 ? ? -158.88 15.97 96 8 GLU A 50 ? ? -160.41 36.84 97 8 ARG B 2 ? ? -100.50 47.06 98 8 ALA B 7 ? ? -122.12 -161.13 99 8 SER B 10 ? ? 40.25 97.80 100 9 ASP A 6 ? ? 70.46 -23.06 101 9 TYR A 10 ? ? -60.38 -107.51 102 9 CYS A 11 ? ? -32.83 122.49 103 9 ILE A 12 ? ? -47.49 -6.98 104 9 LYS A 14 ? ? 67.56 72.69 105 9 GLU A 19 ? ? -56.20 3.27 106 9 ASP A 49 ? ? -159.59 10.82 107 9 GLU A 50 ? ? -158.77 40.85 108 9 ALA B 7 ? ? -171.85 145.04 109 9 ARG B 8 ? ? 55.45 152.93 110 9 SER B 10 ? ? -54.42 -125.49 111 10 LEU A 9 ? ? -62.26 -175.63 112 10 TYR A 10 ? ? -60.49 -106.26 113 10 CYS A 11 ? ? -35.40 134.17 114 10 ILE A 12 ? ? -52.14 -7.28 115 10 LYS A 14 ? ? 71.49 78.67 116 10 GLU A 19 ? ? -58.78 6.51 117 10 CYS A 26 ? ? -47.51 108.38 118 10 GLN A 30 ? ? 85.45 15.47 119 10 GLU A 44 ? ? -42.89 -17.61 120 10 ASP A 49 ? ? -162.99 39.00 121 10 GLU A 50 ? ? -177.21 15.62 122 10 ARG B 2 ? ? -82.92 31.17 123 10 ALA B 7 ? ? 42.33 71.72 124 10 SER B 10 ? ? 174.18 -39.23 125 11 SER A 5 ? ? -142.69 -157.33 126 11 LEU A 9 ? ? -61.39 -171.27 127 11 TYR A 10 ? ? -43.06 -114.38 128 11 CYS A 11 ? ? -30.94 116.80 129 11 GLU A 19 ? ? -56.11 6.90 130 11 CYS A 26 ? ? -55.81 108.14 131 11 GLU A 44 ? ? -41.55 -19.94 132 11 ASP A 49 ? ? -158.67 8.25 133 11 GLU A 50 ? ? -153.69 36.90 134 11 GLU A 60 ? ? 57.53 126.25 135 11 ARG B 2 ? ? 35.58 48.66 136 11 THR B 6 ? ? -109.17 66.28 137 11 ALA B 7 ? ? 44.12 86.77 138 12 LEU A 9 ? ? -60.98 -176.13 139 12 TYR A 10 ? ? -54.46 -106.16 140 12 CYS A 11 ? ? -36.85 133.48 141 12 ILE A 12 ? ? -55.57 -7.08 142 12 LYS A 14 ? ? 78.29 78.61 143 12 PRO A 16 ? ? -73.26 -165.92 144 12 GLU A 19 ? ? -57.43 8.05 145 12 GLN A 30 ? ? 31.43 33.82 146 12 ASP A 49 ? ? -167.91 18.68 147 12 GLU A 50 ? ? -160.56 29.07 148 12 THR A 59 ? ? -145.41 24.28 149 12 ARG B 2 ? ? -92.12 40.49 150 12 THR B 6 ? ? -32.51 89.93 151 12 ALA B 7 ? ? -176.29 122.54 152 12 ARG B 8 ? ? -159.02 -136.47 153 12 LYS B 9 ? ? -136.75 -33.23 154 12 SER B 10 ? ? 56.04 118.04 155 13 ASP A 6 ? ? -179.90 -80.33 156 13 TYR A 10 ? ? -111.56 -103.66 157 13 CYS A 11 ? ? -36.42 120.52 158 13 ILE A 12 ? ? -43.92 -5.91 159 13 LYS A 14 ? ? 89.81 80.20 160 13 GLU A 19 ? ? -57.05 4.26 161 13 GLN A 30 ? ? 80.79 8.07 162 13 ASP A 49 ? ? -164.15 13.83 163 13 GLU A 50 ? ? -159.69 35.23 164 13 THR A 59 ? ? 67.33 63.80 165 13 GLU A 60 ? ? 29.95 34.03 166 13 ARG B 2 ? ? 32.65 50.31 167 13 ALA B 7 ? ? -152.44 72.29 168 14 TYR A 10 ? ? -83.71 -95.00 169 14 CYS A 11 ? ? -36.86 125.54 170 14 ILE A 12 ? ? -53.64 -6.81 171 14 LYS A 14 ? ? 80.73 79.44 172 14 GLU A 19 ? ? -55.67 3.57 173 14 GLN A 30 ? ? 31.94 36.53 174 14 GLU A 44 ? ? -42.07 -19.94 175 14 ASP A 49 ? ? -161.90 25.73 176 14 GLU A 50 ? ? -170.29 39.22 177 14 THR A 59 ? ? -93.90 -74.14 178 14 GLU A 60 ? ? 56.70 141.58 179 14 ARG B 2 ? ? -86.61 32.45 180 14 LYS B 9 ? ? -36.39 86.25 181 15 ASP A 6 ? ? 44.15 91.53 182 15 TYR A 10 ? ? -106.81 -94.16 183 15 CYS A 11 ? ? -35.61 135.04 184 15 ILE A 12 ? ? -52.01 -7.34 185 15 LYS A 14 ? ? 82.53 78.87 186 15 GLU A 19 ? ? -58.55 8.19 187 15 ASP A 49 ? ? -154.02 0.46 188 15 GLU A 50 ? ? -147.98 44.80 189 15 ALA B 7 ? ? 57.35 179.24 190 16 LEU A 9 ? ? -62.36 -174.51 191 16 TYR A 10 ? ? -57.04 -117.53 192 16 CYS A 11 ? ? -34.52 124.74 193 16 ILE A 12 ? ? -55.80 -7.12 194 16 LYS A 14 ? ? 90.11 36.84 195 16 PRO A 16 ? ? -66.91 -162.35 196 16 GLU A 19 ? ? -54.78 7.41 197 16 GLN A 30 ? ? 34.85 34.72 198 16 ASP A 49 ? ? -159.23 10.59 199 16 GLU A 50 ? ? -158.29 41.56 200 16 ARG B 2 ? ? 33.99 41.46 201 16 THR B 6 ? ? -72.16 22.31 202 17 LEU A 9 ? ? -63.15 -172.51 203 17 TYR A 10 ? ? -60.72 -122.63 204 17 CYS A 11 ? ? -33.66 124.39 205 17 ILE A 12 ? ? -52.77 -6.99 206 17 PRO A 16 ? ? -50.29 -174.43 207 17 GLU A 19 ? ? -53.52 4.14 208 17 GLU A 44 ? ? -42.98 -19.13 209 17 ASP A 49 ? ? -160.75 20.29 210 17 GLU A 50 ? ? -169.93 39.61 211 17 THR A 59 ? ? -143.17 46.90 212 17 ARG B 2 ? ? -96.27 58.53 213 17 LYS B 9 ? ? -149.69 -75.09 214 18 TYR A 10 ? ? -122.54 -91.57 215 18 CYS A 11 ? ? -37.17 137.00 216 18 ILE A 12 ? ? -52.10 -6.53 217 18 LYS A 14 ? ? 82.93 78.99 218 18 GLU A 19 ? ? -58.88 8.64 219 18 CYS A 26 ? ? -47.67 107.85 220 18 GLN A 30 ? ? 82.02 16.12 221 18 GLU A 44 ? ? -45.62 -18.30 222 18 ASP A 49 ? ? -159.00 6.92 223 18 GLU A 50 ? ? -147.97 34.28 224 18 THR A 59 ? ? -96.09 -68.95 225 18 GLU A 60 ? ? 58.47 -113.45 226 18 ASP A 61 ? ? 55.19 92.51 227 18 GLN B 5 ? ? -60.22 -139.02 228 18 ARG B 8 ? ? 58.92 117.96 229 18 THR B 11 ? ? 44.28 -86.68 230 19 SER A 5 ? ? 54.67 160.68 231 19 ASP A 6 ? ? 55.35 80.47 232 19 LEU A 9 ? ? -62.06 -174.71 233 19 TYR A 10 ? ? -62.96 -111.04 234 19 CYS A 11 ? ? -34.37 128.85 235 19 ILE A 12 ? ? -50.14 -6.05 236 19 LYS A 14 ? ? 69.41 79.22 237 19 GLU A 19 ? ? -56.60 6.76 238 19 GLU A 44 ? ? -43.37 -18.76 239 19 ASP A 49 ? ? -156.72 12.72 240 19 GLU A 50 ? ? -164.81 43.95 241 19 THR B 6 ? ? 42.66 -161.16 242 19 ALA B 7 ? ? 34.32 98.12 243 19 ARG B 8 ? ? 55.37 160.34 244 20 TYR A 10 ? ? -120.64 -94.41 245 20 CYS A 11 ? ? -35.94 137.66 246 20 ILE A 12 ? ? -51.96 -7.17 247 20 LYS A 14 ? ? 76.97 79.52 248 20 GLU A 19 ? ? -66.07 8.75 249 20 CYS A 26 ? ? -48.35 108.43 250 20 GLN A 30 ? ? 48.95 29.83 251 20 GLU A 44 ? ? -42.16 -17.00 252 20 ASP A 49 ? ? -166.54 36.65 253 20 GLU A 50 ? ? -168.96 11.11 254 20 THR A 59 ? ? -98.03 -64.77 255 20 GLU A 60 ? ? 59.21 16.31 256 20 ASP A 61 ? ? 38.07 -88.82 257 20 ARG B 8 ? ? 61.61 100.22 258 20 THR B 11 ? ? 33.50 -99.60 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #