data_2FWH # _entry.id 2FWH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2FWH RCSB RCSB036394 WWPDB D_1000036394 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2FWE 'crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (oxidized form)' unspecified PDB 2FWF 'high resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (reduced form)' unspecified PDB 2FWG 'high resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (photoreduced form)' unspecified PDB 1vrs ;Crystal Structure Of The Disulfide-Linked Complex Between The N-Terminal and C-Terminal Domain Of The Electron Transfer Catalyst DsbD ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FWH _pdbx_database_status.recvd_initial_deposition_date 2006-02-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stirnimann, C.U.' 1 'Rozhkova, A.' 2 'Grauschopf, U.' 3 'Boeckmann, R.A.' 4 'Glockshuber, R.' 5 'Capitani, G.' 6 'Gruetter, M.G.' 7 # _citation.id primary _citation.title ;High-resolution structures of Escherichia coli cDsbD in different redox states: A combined crystallographic, biochemical and computational study ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 358 _citation.page_first 829 _citation.page_last 845 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16545842 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.02.030 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Stirnimann, C.U.' 1 primary 'Rozhkova, A.' 2 primary 'Grauschopf, U.' 3 primary 'Boeckmann, R.A.' 4 primary 'Glockshuber, R.' 5 primary 'Capitani, G.' 6 primary 'Gruetter, M.G.' 7 # _cell.entry_id 2FWH _cell.length_a 30.289 _cell.length_b 46.072 _cell.length_c 74.070 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FWH _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol:disulfide interchange protein dsbD' 15097.932 1 1.8.1.8 ? 'C-Terminal Domain, Residues 419-546' ? 2 non-polymer syn 'IODIDE ION' 126.904 3 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 4 water nat water 18.015 200 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Protein-disulfide reductase, Disulfide reductase, C-type cytochrome biogenesis protein cycZ, Inner membrane copper tolerance protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATHTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQD VALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQPHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ATHTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQD VALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQPHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 HIS n 1 4 THR n 1 5 ALA n 1 6 GLN n 1 7 THR n 1 8 GLN n 1 9 THR n 1 10 HIS n 1 11 LEU n 1 12 ASN n 1 13 PHE n 1 14 THR n 1 15 GLN n 1 16 ILE n 1 17 LYS n 1 18 THR n 1 19 VAL n 1 20 ASP n 1 21 GLU n 1 22 LEU n 1 23 ASN n 1 24 GLN n 1 25 ALA n 1 26 LEU n 1 27 VAL n 1 28 GLU n 1 29 ALA n 1 30 LYS n 1 31 GLY n 1 32 LYS n 1 33 PRO n 1 34 VAL n 1 35 MET n 1 36 LEU n 1 37 ASP n 1 38 LEU n 1 39 TYR n 1 40 ALA n 1 41 ASP n 1 42 TRP n 1 43 CYS n 1 44 VAL n 1 45 ALA n 1 46 CYS n 1 47 LYS n 1 48 GLU n 1 49 PHE n 1 50 GLU n 1 51 LYS n 1 52 TYR n 1 53 THR n 1 54 PHE n 1 55 SER n 1 56 ASP n 1 57 PRO n 1 58 GLN n 1 59 VAL n 1 60 GLN n 1 61 LYS n 1 62 ALA n 1 63 LEU n 1 64 ALA n 1 65 ASP n 1 66 THR n 1 67 VAL n 1 68 LEU n 1 69 LEU n 1 70 GLN n 1 71 ALA n 1 72 ASN n 1 73 VAL n 1 74 THR n 1 75 ALA n 1 76 ASN n 1 77 ASP n 1 78 ALA n 1 79 GLN n 1 80 ASP n 1 81 VAL n 1 82 ALA n 1 83 LEU n 1 84 LEU n 1 85 LYS n 1 86 HIS n 1 87 LEU n 1 88 ASN n 1 89 VAL n 1 90 LEU n 1 91 GLY n 1 92 LEU n 1 93 PRO n 1 94 THR n 1 95 ILE n 1 96 LEU n 1 97 PHE n 1 98 PHE n 1 99 ASP n 1 100 GLY n 1 101 GLN n 1 102 GLY n 1 103 GLN n 1 104 GLU n 1 105 HIS n 1 106 PRO n 1 107 GLN n 1 108 ALA n 1 109 ARG n 1 110 VAL n 1 111 THR n 1 112 GLY n 1 113 PHE n 1 114 MET n 1 115 ASP n 1 116 ALA n 1 117 GLU n 1 118 THR n 1 119 PHE n 1 120 SER n 1 121 ALA n 1 122 HIS n 1 123 LEU n 1 124 ARG n 1 125 ASP n 1 126 ARG n 1 127 GLN n 1 128 PRO n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'DSBD, DIPZ, CYCZ, CUTA2, B4136' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 ROSETTA' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDSBA3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBD_ECOLI _struct_ref.pdbx_db_accession P36655 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATHTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQD VALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQP ; _struct_ref.pdbx_align_begin 438 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FWH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36655 _struct_ref_seq.db_align_beg 438 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 565 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 419 _struct_ref_seq.pdbx_auth_seq_align_end 546 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FWH HIS A 129 ? UNP P36655 ? ? 'EXPRESSION TAG' 547 1 1 2FWH HIS A 130 ? UNP P36655 ? ? 'EXPRESSION TAG' 548 2 1 2FWH HIS A 131 ? UNP P36655 ? ? 'EXPRESSION TAG' 549 3 1 2FWH HIS A 132 ? UNP P36655 ? ? 'EXPRESSION TAG' 550 4 1 2FWH HIS A 133 ? UNP P36655 ? ? 'EXPRESSION TAG' 551 5 1 2FWH HIS A 134 ? UNP P36655 ? ? 'EXPRESSION TAG' 552 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FWH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.70 _exptl_crystal.density_percent_sol 28.110168 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details ;0.1M ammonium acetate, 0.2M sodium acetate, 0.1M sodium iodide, 40% PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 101.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-06-05 _diffrn_detector.details 'dynamically bendable mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8555 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.8555 # _reflns.entry_id 2FWH _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.00 _reflns.d_resolution_high 0.99 _reflns.d_resolution_low 20 _reflns.number_all ? _reflns.number_obs 58388 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.079 _reflns.pdbx_netI_over_sigmaI 18.8 _reflns.B_iso_Wilson_estimate 6.196 _reflns.pdbx_redundancy 5.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 0.99 _reflns_shell.d_res_low 1.03 _reflns_shell.percent_possible_all 96.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.445 _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2FWH _refine.ls_number_reflns_obs 56874 _refine.ls_number_reflns_all 56874 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15.00 _refine.ls_d_res_high 0.99 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.113 _refine.ls_R_factor_R_free 0.146 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1437 _refine.ls_number_parameters 12144 _refine.ls_number_restraints 17930 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'modified version of 2TRX (see publication)' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2FWH _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 60 _refine_analyze.occupancy_sum_hydrogen 901.70 _refine_analyze.occupancy_sum_non_hydrogen 1107.68 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 242 _refine_hist.number_atoms_total 1353 _refine_hist.d_res_high 0.99 _refine_hist.d_res_low 15.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.030 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0264 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.080 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.089 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.039 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.005 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.045 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.078 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 0.99 _refine_ls_shell.d_res_low ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.105 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.138 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 1208 _refine_ls_shell.number_reflns_obs 46676 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine.entry_id 2FWH _pdbx_refine.R_factor_all_no_cutoff 0.1129 _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff 0.146 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff 0.105 _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff 0.138 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff 1208 _pdbx_refine.number_reflns_obs_4sig_cutoff 46676 _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 2FWH _struct.title 'atomic resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (reduced form at pH7)' _struct.pdbx_descriptor 'Thiol:disulfide interchange protein dsbD (E.C.1.8.1.8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FWH _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'DSBD, THIOREDOXIN-LIKE, C-terminal domain, reduced form at pH7, Oxidoreductase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 18 ? LYS A 30 ? THR A 436 LYS A 448 1 ? 13 HELX_P HELX_P2 2 CYS A 43 ? THR A 53 ? CYS A 461 THR A 471 1 ? 11 HELX_P HELX_P3 3 ASP A 56 ? LEU A 63 ? ASP A 474 LEU A 481 1 ? 8 HELX_P HELX_P4 4 ASP A 77 ? LEU A 87 ? ASP A 495 LEU A 505 1 ? 11 HELX_P HELX_P5 5 HIS A 105 ? ARG A 109 ? HIS A 523 ARG A 527 5 ? 5 HELX_P HELX_P6 6 ASP A 115 ? ARG A 126 ? ASP A 533 ARG A 544 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 92 A . ? LEU 510 A PRO 93 A ? PRO 511 A 1 -4.35 2 LEU 92 A . ? LEU 510 A PRO 93 A ? PRO 511 A 1 -1.75 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 14 ? GLN A 15 ? THR A 432 GLN A 433 A 2 VAL A 67 ? ASN A 72 ? VAL A 485 ASN A 490 A 3 VAL A 34 ? TYR A 39 ? VAL A 452 TYR A 457 A 4 THR A 94 ? PHE A 98 ? THR A 512 PHE A 516 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 14 ? N THR A 432 O LEU A 68 ? O LEU A 486 A 2 3 O LEU A 69 ? O LEU A 487 N MET A 35 ? N MET A 453 A 3 4 N LEU A 36 ? N LEU A 454 O LEU A 96 ? O LEU A 514 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 1001' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 1002' AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 1003' AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PEG A 2001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 GLY A 100 ? GLY A 518 . ? 1_555 ? 2 AC2 2 GLN A 107 ? GLN A 525 . ? 1_555 ? 3 AC2 2 ARG A 126 ? ARG A 544 . ? 1_555 ? 4 AC3 1 ARG A 126 ? ARG A 544 . ? 1_555 ? 5 AC4 8 HOH F . ? HOH A 15 . ? 1_555 ? 6 AC4 8 HOH F . ? HOH A 99 . ? 1_555 ? 7 AC4 8 HOH F . ? HOH A 153 . ? 1_555 ? 8 AC4 8 HOH F . ? HOH A 156 . ? 1_555 ? 9 AC4 8 LYS A 51 ? LYS A 469 . ? 4_455 ? 10 AC4 8 ARG A 109 ? ARG A 527 . ? 1_555 ? 11 AC4 8 MET A 114 ? MET A 532 . ? 1_555 ? 12 AC4 8 HIS A 122 ? HIS A 540 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FWH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 2FWH _atom_sites.fract_transf_matrix[1][1] 0.033015 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021705 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013501 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 419 ? ? ? A . n A 1 2 THR 2 420 ? ? ? A . n A 1 3 HIS 3 421 ? ? ? A . n A 1 4 THR 4 422 ? ? ? A . n A 1 5 ALA 5 423 ? ? ? A . n A 1 6 GLN 6 424 ? ? ? A . n A 1 7 THR 7 425 ? ? ? A . n A 1 8 GLN 8 426 ? ? ? A . n A 1 9 THR 9 427 ? ? ? A . n A 1 10 HIS 10 428 428 HIS HIS A . n A 1 11 LEU 11 429 429 LEU LEU A . n A 1 12 ASN 12 430 430 ASN ASN A . n A 1 13 PHE 13 431 431 PHE PHE A . n A 1 14 THR 14 432 432 THR THR A . n A 1 15 GLN 15 433 433 GLN GLN A . n A 1 16 ILE 16 434 434 ILE ILE A . n A 1 17 LYS 17 435 435 LYS LYS A . n A 1 18 THR 18 436 436 THR THR A . n A 1 19 VAL 19 437 437 VAL VAL A . n A 1 20 ASP 20 438 438 ASP ASP A . n A 1 21 GLU 21 439 439 GLU GLU A . n A 1 22 LEU 22 440 440 LEU LEU A . n A 1 23 ASN 23 441 441 ASN ASN A . n A 1 24 GLN 24 442 442 GLN GLN A . n A 1 25 ALA 25 443 443 ALA ALA A . n A 1 26 LEU 26 444 444 LEU LEU A . n A 1 27 VAL 27 445 445 VAL VAL A . n A 1 28 GLU 28 446 446 GLU GLU A . n A 1 29 ALA 29 447 447 ALA ALA A . n A 1 30 LYS 30 448 448 LYS LYS A . n A 1 31 GLY 31 449 449 GLY GLY A . n A 1 32 LYS 32 450 450 LYS LYS A . n A 1 33 PRO 33 451 451 PRO PRO A . n A 1 34 VAL 34 452 452 VAL VAL A . n A 1 35 MET 35 453 453 MET MET A . n A 1 36 LEU 36 454 454 LEU LEU A . n A 1 37 ASP 37 455 455 ASP ASP A . n A 1 38 LEU 38 456 456 LEU LEU A . n A 1 39 TYR 39 457 457 TYR TYR A . n A 1 40 ALA 40 458 458 ALA ALA A . n A 1 41 ASP 41 459 459 ASP ASP A . n A 1 42 TRP 42 460 460 TRP TRP A . n A 1 43 CYS 43 461 461 CYS CYS A . n A 1 44 VAL 44 462 462 VAL VAL A . n A 1 45 ALA 45 463 463 ALA ALA A . n A 1 46 CYS 46 464 464 CYS CYS A . n A 1 47 LYS 47 465 465 LYS LYS A . n A 1 48 GLU 48 466 466 GLU GLU A . n A 1 49 PHE 49 467 467 PHE PHE A . n A 1 50 GLU 50 468 468 GLU GLU A . n A 1 51 LYS 51 469 469 LYS LYS A . n A 1 52 TYR 52 470 470 TYR TYR A . n A 1 53 THR 53 471 471 THR THR A . n A 1 54 PHE 54 472 472 PHE PHE A . n A 1 55 SER 55 473 473 SER SER A . n A 1 56 ASP 56 474 474 ASP ASP A . n A 1 57 PRO 57 475 475 PRO PRO A . n A 1 58 GLN 58 476 476 GLN GLN A . n A 1 59 VAL 59 477 477 VAL VAL A . n A 1 60 GLN 60 478 478 GLN GLN A . n A 1 61 LYS 61 479 479 LYS LYS A . n A 1 62 ALA 62 480 480 ALA ALA A . n A 1 63 LEU 63 481 481 LEU LEU A . n A 1 64 ALA 64 482 482 ALA ALA A . n A 1 65 ASP 65 483 483 ASP ASP A . n A 1 66 THR 66 484 484 THR THR A . n A 1 67 VAL 67 485 485 VAL VAL A . n A 1 68 LEU 68 486 486 LEU LEU A . n A 1 69 LEU 69 487 487 LEU LEU A . n A 1 70 GLN 70 488 488 GLN GLN A . n A 1 71 ALA 71 489 489 ALA ALA A . n A 1 72 ASN 72 490 490 ASN ASN A . n A 1 73 VAL 73 491 491 VAL VAL A . n A 1 74 THR 74 492 492 THR THR A . n A 1 75 ALA 75 493 493 ALA ALA A . n A 1 76 ASN 76 494 494 ASN ASN A . n A 1 77 ASP 77 495 495 ASP ASP A . n A 1 78 ALA 78 496 496 ALA ALA A . n A 1 79 GLN 79 497 497 GLN GLN A . n A 1 80 ASP 80 498 498 ASP ASP A . n A 1 81 VAL 81 499 499 VAL VAL A . n A 1 82 ALA 82 500 500 ALA ALA A . n A 1 83 LEU 83 501 501 LEU LEU A . n A 1 84 LEU 84 502 502 LEU LEU A . n A 1 85 LYS 85 503 503 LYS LYS A . n A 1 86 HIS 86 504 504 HIS HIS A . n A 1 87 LEU 87 505 505 LEU LEU A . n A 1 88 ASN 88 506 506 ASN ASN A . n A 1 89 VAL 89 507 507 VAL VAL A . n A 1 90 LEU 90 508 508 LEU LEU A . n A 1 91 GLY 91 509 509 GLY GLY A . n A 1 92 LEU 92 510 510 LEU LEU A . n A 1 93 PRO 93 511 511 PRO PRO A . n A 1 94 THR 94 512 512 THR THR A . n A 1 95 ILE 95 513 513 ILE ILE A . n A 1 96 LEU 96 514 514 LEU LEU A . n A 1 97 PHE 97 515 515 PHE PHE A . n A 1 98 PHE 98 516 516 PHE PHE A . n A 1 99 ASP 99 517 517 ASP ASP A . n A 1 100 GLY 100 518 518 GLY GLY A . n A 1 101 GLN 101 519 519 GLN GLN A . n A 1 102 GLY 102 520 520 GLY GLY A . n A 1 103 GLN 103 521 521 GLN GLN A . n A 1 104 GLU 104 522 522 GLU GLU A . n A 1 105 HIS 105 523 523 HIS HIS A . n A 1 106 PRO 106 524 524 PRO PRO A . n A 1 107 GLN 107 525 525 GLN GLN A . n A 1 108 ALA 108 526 526 ALA ALA A . n A 1 109 ARG 109 527 527 ARG ARG A . n A 1 110 VAL 110 528 528 VAL VAL A . n A 1 111 THR 111 529 529 THR THR A . n A 1 112 GLY 112 530 530 GLY GLY A . n A 1 113 PHE 113 531 531 PHE PHE A . n A 1 114 MET 114 532 532 MET MET A . n A 1 115 ASP 115 533 533 ASP ASP A . n A 1 116 ALA 116 534 534 ALA ALA A . n A 1 117 GLU 117 535 535 GLU GLU A . n A 1 118 THR 118 536 536 THR THR A . n A 1 119 PHE 119 537 537 PHE PHE A . n A 1 120 SER 120 538 538 SER SER A . n A 1 121 ALA 121 539 539 ALA ALA A . n A 1 122 HIS 122 540 540 HIS HIS A . n A 1 123 LEU 123 541 541 LEU LEU A . n A 1 124 ARG 124 542 542 ARG ARG A . n A 1 125 ASP 125 543 543 ASP ASP A . n A 1 126 ARG 126 544 544 ARG ARG A . n A 1 127 GLN 127 545 ? ? ? A . n A 1 128 PRO 128 546 ? ? ? A . n A 1 129 HIS 129 547 ? ? ? A . n A 1 130 HIS 130 548 ? ? ? A . n A 1 131 HIS 131 549 ? ? ? A . n A 1 132 HIS 132 550 ? ? ? A . n A 1 133 HIS 133 551 ? ? ? A . n A 1 134 HIS 134 552 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IOD 1 1001 1001 IOD IOD A . C 2 IOD 1 1002 1002 IOD IOD A . D 2 IOD 1 1003 1003 IOD IOD A . E 3 PEG 1 2001 2001 PEG PEG A . F 4 HOH 1 1 1 HOH HOH A . F 4 HOH 2 2 2 HOH HOH A . F 4 HOH 3 3 3 HOH HOH A . F 4 HOH 4 4 4 HOH HOH A . F 4 HOH 5 5 5 HOH HOH A . F 4 HOH 6 6 6 HOH HOH A . F 4 HOH 7 7 7 HOH HOH A . F 4 HOH 8 8 8 HOH HOH A . F 4 HOH 9 9 9 HOH HOH A . F 4 HOH 10 10 10 HOH HOH A . F 4 HOH 11 11 11 HOH HOH A . F 4 HOH 12 12 12 HOH HOH A . F 4 HOH 13 13 13 HOH HOH A . F 4 HOH 14 14 14 HOH HOH A . F 4 HOH 15 15 15 HOH HOH A . F 4 HOH 16 16 16 HOH HOH A . F 4 HOH 17 17 17 HOH HOH A . F 4 HOH 18 18 18 HOH HOH A . F 4 HOH 19 19 19 HOH HOH A . F 4 HOH 20 20 20 HOH HOH A . F 4 HOH 21 21 21 HOH HOH A . F 4 HOH 22 22 22 HOH HOH A . F 4 HOH 23 23 23 HOH HOH A . F 4 HOH 24 24 24 HOH HOH A . F 4 HOH 25 25 25 HOH HOH A . F 4 HOH 26 26 26 HOH HOH A . F 4 HOH 27 27 27 HOH HOH A . F 4 HOH 28 28 28 HOH HOH A . F 4 HOH 29 29 29 HOH HOH A . F 4 HOH 30 30 30 HOH HOH A . F 4 HOH 31 31 31 HOH HOH A . F 4 HOH 32 32 32 HOH HOH A . F 4 HOH 33 33 33 HOH HOH A . F 4 HOH 34 34 34 HOH HOH A . F 4 HOH 35 35 35 HOH HOH A . F 4 HOH 36 36 36 HOH HOH A . F 4 HOH 37 37 37 HOH HOH A . F 4 HOH 38 38 38 HOH HOH A . F 4 HOH 39 39 39 HOH HOH A . F 4 HOH 40 40 40 HOH HOH A . F 4 HOH 41 41 41 HOH HOH A . F 4 HOH 42 42 42 HOH HOH A . F 4 HOH 43 43 43 HOH HOH A . F 4 HOH 44 44 44 HOH HOH A . F 4 HOH 45 45 45 HOH HOH A . F 4 HOH 46 46 46 HOH HOH A . F 4 HOH 47 47 47 HOH HOH A . F 4 HOH 48 48 48 HOH HOH A . F 4 HOH 49 49 49 HOH HOH A . F 4 HOH 50 50 50 HOH HOH A . F 4 HOH 51 51 51 HOH HOH A . F 4 HOH 52 52 52 HOH HOH A . F 4 HOH 53 53 53 HOH HOH A . F 4 HOH 54 54 54 HOH HOH A . F 4 HOH 55 55 55 HOH HOH A . F 4 HOH 56 56 56 HOH HOH A . F 4 HOH 57 57 57 HOH HOH A . F 4 HOH 58 58 58 HOH HOH A . F 4 HOH 59 59 59 HOH HOH A . F 4 HOH 60 60 60 HOH HOH A . F 4 HOH 61 61 61 HOH HOH A . F 4 HOH 62 62 62 HOH HOH A . F 4 HOH 63 63 63 HOH HOH A . F 4 HOH 64 65 65 HOH HOH A . F 4 HOH 65 66 66 HOH HOH A . F 4 HOH 66 67 67 HOH HOH A . F 4 HOH 67 68 68 HOH HOH A . F 4 HOH 68 69 69 HOH HOH A . F 4 HOH 69 70 70 HOH HOH A . F 4 HOH 70 71 71 HOH HOH A . F 4 HOH 71 72 72 HOH HOH A . F 4 HOH 72 73 73 HOH HOH A . F 4 HOH 73 74 74 HOH HOH A . F 4 HOH 74 75 75 HOH HOH A . F 4 HOH 75 76 76 HOH HOH A . F 4 HOH 76 77 77 HOH HOH A . F 4 HOH 77 78 78 HOH HOH A . F 4 HOH 78 79 79 HOH HOH A . F 4 HOH 79 80 80 HOH HOH A . F 4 HOH 80 81 81 HOH HOH A . F 4 HOH 81 82 82 HOH HOH A . F 4 HOH 82 83 83 HOH HOH A . F 4 HOH 83 84 84 HOH HOH A . F 4 HOH 84 85 85 HOH HOH A . F 4 HOH 85 86 86 HOH HOH A . F 4 HOH 86 87 87 HOH HOH A . F 4 HOH 87 88 88 HOH HOH A . F 4 HOH 88 89 89 HOH HOH A . F 4 HOH 89 90 90 HOH HOH A . F 4 HOH 90 91 91 HOH HOH A . F 4 HOH 91 92 92 HOH HOH A . F 4 HOH 92 93 93 HOH HOH A . F 4 HOH 93 94 94 HOH HOH A . F 4 HOH 94 95 95 HOH HOH A . F 4 HOH 95 96 96 HOH HOH A . F 4 HOH 96 97 97 HOH HOH A . F 4 HOH 97 98 98 HOH HOH A . F 4 HOH 98 99 99 HOH HOH A . F 4 HOH 99 100 100 HOH HOH A . F 4 HOH 100 101 101 HOH HOH A . F 4 HOH 101 102 102 HOH HOH A . F 4 HOH 102 103 103 HOH HOH A . F 4 HOH 103 104 104 HOH HOH A . F 4 HOH 104 105 105 HOH HOH A . F 4 HOH 105 106 106 HOH HOH A . F 4 HOH 106 107 107 HOH HOH A . F 4 HOH 107 108 108 HOH HOH A . F 4 HOH 108 109 109 HOH HOH A . F 4 HOH 109 110 110 HOH HOH A . F 4 HOH 110 111 111 HOH HOH A . F 4 HOH 111 112 112 HOH HOH A . F 4 HOH 112 113 113 HOH HOH A . F 4 HOH 113 114 114 HOH HOH A . F 4 HOH 114 115 115 HOH HOH A . F 4 HOH 115 116 116 HOH HOH A . F 4 HOH 116 117 117 HOH HOH A . F 4 HOH 117 118 118 HOH HOH A . F 4 HOH 118 119 119 HOH HOH A . F 4 HOH 119 120 120 HOH HOH A . F 4 HOH 120 121 121 HOH HOH A . F 4 HOH 121 122 122 HOH HOH A . F 4 HOH 122 123 123 HOH HOH A . F 4 HOH 123 124 124 HOH HOH A . F 4 HOH 124 125 125 HOH HOH A . F 4 HOH 125 126 126 HOH HOH A . F 4 HOH 126 127 127 HOH HOH A . F 4 HOH 127 128 128 HOH HOH A . F 4 HOH 128 129 129 HOH HOH A . F 4 HOH 129 130 130 HOH HOH A . F 4 HOH 130 131 131 HOH HOH A . F 4 HOH 131 132 132 HOH HOH A . F 4 HOH 132 133 133 HOH HOH A . F 4 HOH 133 134 134 HOH HOH A . F 4 HOH 134 135 135 HOH HOH A . F 4 HOH 135 136 136 HOH HOH A . F 4 HOH 136 137 137 HOH HOH A . F 4 HOH 137 138 138 HOH HOH A . F 4 HOH 138 139 139 HOH HOH A . F 4 HOH 139 140 140 HOH HOH A . F 4 HOH 140 141 141 HOH HOH A . F 4 HOH 141 142 142 HOH HOH A . F 4 HOH 142 143 143 HOH HOH A . F 4 HOH 143 144 144 HOH HOH A . F 4 HOH 144 145 145 HOH HOH A . F 4 HOH 145 146 146 HOH HOH A . F 4 HOH 146 147 147 HOH HOH A . F 4 HOH 147 148 148 HOH HOH A . F 4 HOH 148 149 149 HOH HOH A . F 4 HOH 149 150 150 HOH HOH A . F 4 HOH 150 151 151 HOH HOH A . F 4 HOH 151 152 152 HOH HOH A . F 4 HOH 152 153 153 HOH HOH A . F 4 HOH 153 154 154 HOH HOH A . F 4 HOH 154 155 155 HOH HOH A . F 4 HOH 155 156 156 HOH HOH A . F 4 HOH 156 157 157 HOH HOH A . F 4 HOH 157 158 158 HOH HOH A . F 4 HOH 158 159 159 HOH HOH A . F 4 HOH 159 160 160 HOH HOH A . F 4 HOH 160 161 161 HOH HOH A . F 4 HOH 161 162 162 HOH HOH A . F 4 HOH 162 163 163 HOH HOH A . F 4 HOH 163 164 164 HOH HOH A . F 4 HOH 164 165 165 HOH HOH A . F 4 HOH 165 166 166 HOH HOH A . F 4 HOH 166 167 167 HOH HOH A . F 4 HOH 167 168 168 HOH HOH A . F 4 HOH 168 169 169 HOH HOH A . F 4 HOH 169 170 170 HOH HOH A . F 4 HOH 170 171 171 HOH HOH A . F 4 HOH 171 172 172 HOH HOH A . F 4 HOH 172 173 173 HOH HOH A . F 4 HOH 173 174 174 HOH HOH A . F 4 HOH 174 175 175 HOH HOH A . F 4 HOH 175 176 176 HOH HOH A . F 4 HOH 176 177 177 HOH HOH A . F 4 HOH 177 178 178 HOH HOH A . F 4 HOH 178 179 179 HOH HOH A . F 4 HOH 179 180 180 HOH HOH A . F 4 HOH 180 181 181 HOH HOH A . F 4 HOH 181 182 182 HOH HOH A . F 4 HOH 182 183 183 HOH HOH A . F 4 HOH 183 186 186 HOH HOH A . F 4 HOH 184 187 187 HOH HOH A . F 4 HOH 185 188 188 HOH HOH A . F 4 HOH 186 189 189 HOH HOH A . F 4 HOH 187 191 191 HOH HOH A . F 4 HOH 188 192 192 HOH HOH A . F 4 HOH 189 193 193 HOH HOH A . F 4 HOH 190 194 194 HOH HOH A . F 4 HOH 191 196 196 HOH HOH A . F 4 HOH 192 197 197 HOH HOH A . F 4 HOH 193 198 198 HOH HOH A . F 4 HOH 194 199 199 HOH HOH A . F 4 HOH 195 201 201 HOH HOH A . F 4 HOH 196 202 202 HOH HOH A . F 4 HOH 197 203 203 HOH HOH A . F 4 HOH 198 204 204 HOH HOH A . F 4 HOH 199 205 205 HOH HOH A . F 4 HOH 200 206 206 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELX 'model building' . ? 1 SHELXL-97 refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 AMoRE phasing . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 438 ? ? CG A ASP 438 ? ? OD1 A ASP 438 ? ? 123.90 118.30 5.60 0.90 N 2 1 NE A ARG 527 ? ? CZ A ARG 527 ? ? NH2 A ARG 527 ? ? 116.69 120.30 -3.61 0.50 N 3 1 NE A ARG 542 ? A CZ A ARG 542 ? A NH1 A ARG 542 ? A 124.75 120.30 4.45 0.50 N 4 1 NE A ARG 542 ? B CZ A ARG 542 ? B NH1 A ARG 542 ? B 124.39 120.30 4.09 0.50 N 5 1 NE A ARG 542 ? A CZ A ARG 542 ? A NH2 A ARG 542 ? A 115.21 120.30 -5.09 0.50 N 6 1 NE A ARG 542 ? B CZ A ARG 542 ? B NH2 A ARG 542 ? B 114.96 120.30 -5.34 0.50 N 7 1 NE A ARG 544 ? A CZ A ARG 544 ? A NH2 A ARG 544 ? A 124.75 120.30 4.45 0.50 N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLN 525 ? CD C A GLN 107 CD 2 1 Y 0 A GLN 525 ? OE1 C A GLN 107 OE1 3 1 Y 0 A GLN 525 ? NE2 C A GLN 107 NE2 4 1 N 1 A PEG 2001 ? O4 ? E PEG 1 O4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 419 ? A ALA 1 2 1 Y 1 A THR 420 ? A THR 2 3 1 Y 1 A HIS 421 ? A HIS 3 4 1 Y 1 A THR 422 ? A THR 4 5 1 Y 1 A ALA 423 ? A ALA 5 6 1 Y 1 A GLN 424 ? A GLN 6 7 1 Y 1 A THR 425 ? A THR 7 8 1 Y 1 A GLN 426 ? A GLN 8 9 1 Y 1 A THR 427 ? A THR 9 10 1 Y 1 A GLN 545 ? A GLN 127 11 1 Y 1 A PRO 546 ? A PRO 128 12 1 Y 1 A HIS 547 ? A HIS 129 13 1 Y 1 A HIS 548 ? A HIS 130 14 1 Y 1 A HIS 549 ? A HIS 131 15 1 Y 1 A HIS 550 ? A HIS 132 16 1 Y 1 A HIS 551 ? A HIS 133 17 1 Y 1 A HIS 552 ? A HIS 134 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 'DI(HYDROXYETHYL)ETHER' PEG 4 water HOH #