data_2FZ5 # _entry.id 2FZ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FZ5 pdb_00002fz5 10.2210/pdb2fz5/pdb RCSB RCSB036485 ? ? WWPDB D_1000036485 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FZ5 _pdbx_database_status.recvd_initial_deposition_date 2006-02-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'van Mierlo, C.P.M.' 1 'Lijnzaad, P.' 2 'Vervoort, J.' 3 'Mueller, F.' 4 'Berendsen, H.J.' 5 'de Vlieg, J.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Tertiary structure of two-electron reduced Megasphaera elsdenii flavodoxin and some implications, as determined by two-dimensional 1H NMR and restrained molecular dynamics ; Eur.J.Biochem. 194 185 198 1990 EJBCAI IX 0014-2956 0262 ? 2253614 10.1111/j.1432-1033.1990.tb19444.x 1 ;Secondary and tertiary structure characteristics of Megasphaera elsdenii flavodoxin in the reduced state as determined by two-dimensional 1H NMR ; Eur.J.Biochem. 189 589 600 1990 EJBCAI IX 0014-2956 0262 ? 2161759 10.1111/j.1432-1033.1990.tb15527.x 2 'A two-dimensional 1H NMR study on Megasphaera elsdenii flavodoxin in the reduced state: sequential assignments' Eur.J.Biochem. 187 521 541 1990 EJBCAI IX 0014-2956 0262 ? 2303055 10.1111/j.1432-1033.1990.tb15334.x 3 ;A two-dimensional 1H NMR study on Megasphaera elsdenii flavodoxin in the oxidized state and some comparisons with the two-electron reduced state ; Eur.J.Biochem. 194 199 216 1990 EJBCAI IX 0014-2956 0262 ? 2253616 10.1111/j.1432-1033.1990.tb19445.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'van Mierlo, C.P.M.' 1 ? primary 'Lijnzaad, P.' 2 ? primary 'Vervoort, J.' 3 ? primary 'Mueller, F.' 4 ? primary 'Berendsen, H.J.' 5 ? primary 'de Vlieg, J.' 6 ? 1 'van Mierlo, C.P.M.' 7 ? 1 'Mueller, F.' 8 ? 1 'Vervoort, J.' 9 ? 2 'van Mierlo, C.P.M.' 10 ? 2 'Vervoort, J.' 11 ? 2 'Mueller, F.' 12 ? 2 'Bacher, A.' 13 ? 3 'van Mierlo, C.P.M.' 14 ? 3 'van der Sanden, B.P.' 15 ? 3 'van Woensel, P.' 16 ? 3 'Mueller, F.' 17 ? 3 'Vervoort, J.' 18 ? # _cell.entry_id 2FZ5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2FZ5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Flavodoxin 14561.183 1 ? ? ? ? 2 non-polymer syn '1-DEOXY-1-(7,8-DIMETHYL-2,4-DIOXO-3,4-DIHYDRO-2H-BENZO[G]PTERIDIN-1-ID-10(5H)-YL)-5-O-PHOSPHONATO-D-RIBITOL' 458.360 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVASKDVILLGCPAMGSEELEDSVVEPFFTDLAPKLKG KKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIVNEMPDNAPECKELGEAAAKA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVASKDVILLGCPAMGSEELEDSVVEPFFTDLAPKLKG KKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIVNEMPDNAPECKELGEAAAKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 GLU n 1 4 ILE n 1 5 VAL n 1 6 TYR n 1 7 TRP n 1 8 SER n 1 9 GLY n 1 10 THR n 1 11 GLY n 1 12 ASN n 1 13 THR n 1 14 GLU n 1 15 ALA n 1 16 MET n 1 17 ALA n 1 18 ASN n 1 19 GLU n 1 20 ILE n 1 21 GLU n 1 22 ALA n 1 23 ALA n 1 24 VAL n 1 25 LYS n 1 26 ALA n 1 27 ALA n 1 28 GLY n 1 29 ALA n 1 30 ASP n 1 31 VAL n 1 32 GLU n 1 33 SER n 1 34 VAL n 1 35 ARG n 1 36 PHE n 1 37 GLU n 1 38 ASP n 1 39 THR n 1 40 ASN n 1 41 VAL n 1 42 ASP n 1 43 ASP n 1 44 VAL n 1 45 ALA n 1 46 SER n 1 47 LYS n 1 48 ASP n 1 49 VAL n 1 50 ILE n 1 51 LEU n 1 52 LEU n 1 53 GLY n 1 54 CYS n 1 55 PRO n 1 56 ALA n 1 57 MET n 1 58 GLY n 1 59 SER n 1 60 GLU n 1 61 GLU n 1 62 LEU n 1 63 GLU n 1 64 ASP n 1 65 SER n 1 66 VAL n 1 67 VAL n 1 68 GLU n 1 69 PRO n 1 70 PHE n 1 71 PHE n 1 72 THR n 1 73 ASP n 1 74 LEU n 1 75 ALA n 1 76 PRO n 1 77 LYS n 1 78 LEU n 1 79 LYS n 1 80 GLY n 1 81 LYS n 1 82 LYS n 1 83 VAL n 1 84 GLY n 1 85 LEU n 1 86 PHE n 1 87 GLY n 1 88 SER n 1 89 TYR n 1 90 GLY n 1 91 TRP n 1 92 GLY n 1 93 SER n 1 94 GLY n 1 95 GLU n 1 96 TRP n 1 97 MET n 1 98 ASP n 1 99 ALA n 1 100 TRP n 1 101 LYS n 1 102 GLN n 1 103 ARG n 1 104 THR n 1 105 GLU n 1 106 ASP n 1 107 THR n 1 108 GLY n 1 109 ALA n 1 110 THR n 1 111 VAL n 1 112 ILE n 1 113 GLY n 1 114 THR n 1 115 ALA n 1 116 ILE n 1 117 VAL n 1 118 ASN n 1 119 GLU n 1 120 MET n 1 121 PRO n 1 122 ASP n 1 123 ASN n 1 124 ALA n 1 125 PRO n 1 126 GLU n 1 127 CYS n 1 128 LYS n 1 129 GLU n 1 130 LEU n 1 131 GLY n 1 132 GLU n 1 133 ALA n 1 134 ALA n 1 135 ALA n 1 136 LYS n 1 137 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Megasphaera elsdenii' _entity_src_nat.pdbx_ncbi_taxonomy_id 907 _entity_src_nat.genus Megasphaera _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FLAV_MEGEL _struct_ref.pdbx_db_accession P00321 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVASKDVILLGCPAMGSEELEDSVVEPFFTDLAPKLKG KKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIVNEMPDNAPECKELGEAAAKA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FZ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00321 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FNR non-polymer . '1-DEOXY-1-(7,8-DIMETHYL-2,4-DIOXO-3,4-DIHYDRO-2H-BENZO[G]PTERIDIN-1-ID-10(5H)-YL)-5-O-PHOSPHONATO-D-RIBITOL' 'TWO ELECTRON REDUCED FLAVIN MONONUCLEOTIDE' 'C17 H23 N4 O9 P' 458.360 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 COSY 1 2 1 'double quantum filtered COSY' 1 3 1 'NOESY (mixing 200ms)' 1 4 1 'NOESY (mixing 50, 100, 150 ms)' 4 5 1 'Double Quantum spectra' 1 6 1 'Homonuclear Hartmann Hahn transfer spectra' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 ? 8.3 ? . K 2 306 ? 8.3 ? . K 3 310 ? 8.3 ? . K 4 314 ? 8.3 ? . K 5 316 ? 8.3 ? . K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '6-10 mM protein, potassium phosphate/potassium pyrophosphate 75-200 mM, pH 8.3, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '6-10 mM protein, potassium phosphate/potassium pyrophosphate 75-200 mM, pH 8.3, 99.9% D2O' '99.9% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 WM Bruker 500 ? 2 AM Bruker 500 ? 3 AM Bruker 600 ? # _pdbx_nmr_refine.entry_id 2FZ5 _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ;The Xray structure of the semiquinone state of Clostridium MP flavodoxin was used as a starting structure for restrained molecular dynamics (RMD) calculations in vacuo (van Mierlo et al. Eur. J. Biochem. 194, 185 - 198 (1990)). 509 distance restraints, 293 medium, 216 long-range were used in refinement. One repulsive restraint, between N5H of FMN and NH of E60 was included. RMD run was of 120 ps. During the first 50 ps the force constant was gradually increased to a high value of 4000 kJmol-1nm-2. From 50 ps on, the force constant was kept constant. The time span of 60-120 ps, at a time resolution of 0.02 ps, was used for calculating the average structure. The time-averaged (not energy minimised) structure has a potential energy -2278 +/- 122 kJmol-1, time-averaged sum of all violations is 2.27 nm, largest occuring violation is 66 pm ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2FZ5 _pdbx_nmr_details.text ;NOESY spectra had mixing times 50, 100, 150 and 200 ms. Double Quantum spectra had a delay of 32 ms. Homonuclear Hartmann Hahn transfer spectra (using MLEV-17 composite pulse cycling) had mixing times 10-160 ms ; # _pdbx_nmr_ensemble.entry_id 2FZ5 _pdbx_nmr_ensemble.conformers_calculated_total_number 3000 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FZ5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'averaging the restrained molecular dynamics trajectory in the range 60-120 ps.' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection DISNMR ? Bruker 1 'structure solution' GROMOS ? 'van Gunsteren and Berendsen' 2 refinement GROMOS ? 'van Gunsteren and Berendsen' 3 # _exptl.entry_id 2FZ5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2FZ5 _struct.title 'Solution structure of two-electron reduced Megasphaera elsdenii flavodoxin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FZ5 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'alpha/beta doubly-wound topology, non-covalently bound FMN, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 11 ? ALA A 27 ? GLY A 11 ALA A 27 1 ? 17 HELX_P HELX_P2 2 ASN A 40 ? SER A 46 ? ASN A 40 SER A 46 1 ? 7 HELX_P HELX_P3 3 GLU A 63 ? ALA A 75 ? GLU A 63 ALA A 75 1 ? 13 HELX_P HELX_P4 4 PRO A 76 ? LEU A 78 ? PRO A 76 LEU A 78 5 ? 3 HELX_P HELX_P5 5 GLY A 94 ? THR A 107 ? GLY A 94 THR A 107 1 ? 14 HELX_P HELX_P6 6 PRO A 125 ? LYS A 136 ? PRO A 125 LYS A 136 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 31 ? ARG A 35 ? VAL A 31 ARG A 35 A 2 VAL A 2 ? TYR A 6 ? VAL A 2 TYR A 6 A 3 VAL A 49 ? GLY A 53 ? VAL A 49 GLY A 53 A 4 LYS A 82 ? TYR A 89 ? LYS A 82 TYR A 89 A 5 THR A 110 ? ASN A 118 ? THR A 110 ASN A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 32 ? O GLU A 32 N VAL A 2 ? N VAL A 2 A 2 3 N VAL A 5 ? N VAL A 5 O LEU A 51 ? O LEU A 51 A 3 4 N ILE A 50 ? N ILE A 50 O LYS A 82 ? O LYS A 82 A 4 5 N TYR A 89 ? N TYR A 89 O VAL A 117 ? O VAL A 117 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FNR _struct_site.pdbx_auth_seq_id 138 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'BINDING SITE FOR RESIDUE FNR A 138' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 TRP A 7 ? TRP A 7 . ? 1_555 ? 2 AC1 15 GLY A 9 ? GLY A 9 . ? 1_555 ? 3 AC1 15 THR A 10 ? THR A 10 . ? 1_555 ? 4 AC1 15 ASN A 12 ? ASN A 12 . ? 1_555 ? 5 AC1 15 PRO A 55 ? PRO A 55 . ? 1_555 ? 6 AC1 15 ALA A 56 ? ALA A 56 . ? 1_555 ? 7 AC1 15 MET A 57 ? MET A 57 . ? 1_555 ? 8 AC1 15 GLY A 58 ? GLY A 58 . ? 1_555 ? 9 AC1 15 GLU A 60 ? GLU A 60 . ? 1_555 ? 10 AC1 15 SER A 88 ? SER A 88 . ? 1_555 ? 11 AC1 15 TYR A 89 ? TYR A 89 . ? 1_555 ? 12 AC1 15 GLY A 90 ? GLY A 90 . ? 1_555 ? 13 AC1 15 TRP A 91 ? TRP A 91 . ? 1_555 ? 14 AC1 15 GLY A 92 ? GLY A 92 . ? 1_555 ? 15 AC1 15 GLU A 119 ? GLU A 119 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FZ5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FZ5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FNR _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 138 _pdbx_nonpoly_scheme.auth_seq_num 138 _pdbx_nonpoly_scheme.pdb_mon_id FNR _pdbx_nonpoly_scheme.auth_mon_id FNR _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-14 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TRP _pdbx_validate_close_contact.auth_seq_id_1 7 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 13 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 OD1 A ASN 118 ? ? CG A ASN 118 ? ? ND2 A ASN 118 ? ? 96.91 121.90 -24.99 2.30 N 2 1 CB A ASN 118 ? ? CG A ASN 118 ? ? OD1 A ASN 118 ? ? 135.65 121.60 14.05 2.00 N 3 1 CB A ASN 118 ? ? CG A ASN 118 ? ? ND2 A ASN 118 ? ? 100.83 116.70 -15.87 2.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 66 ? ? -122.38 -59.74 2 1 LEU A 78 ? ? -107.44 59.95 3 1 LYS A 81 ? ? -49.43 152.19 4 1 ILE A 112 ? ? -90.64 53.61 5 1 GLU A 119 ? ? 62.31 -73.62 6 1 PRO A 121 ? ? -63.04 -177.13 7 1 ASP A 122 ? ? 72.66 -37.11 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id TRP _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 96 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.76 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 35 ? ? 0.107 'SIDE CHAIN' 2 1 PHE A 70 ? ? 0.078 'SIDE CHAIN' 3 1 PHE A 71 ? ? 0.077 'SIDE CHAIN' 4 1 ASN A 118 ? ? 0.163 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '1-DEOXY-1-(7,8-DIMETHYL-2,4-DIOXO-3,4-DIHYDRO-2H-BENZO[G]PTERIDIN-1-ID-10(5H)-YL)-5-O-PHOSPHONATO-D-RIBITOL' _pdbx_entity_nonpoly.comp_id FNR #