data_2G64 # _entry.id 2G64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2G64 pdb_00002g64 10.2210/pdb2g64/pdb RCSB RCSB036735 ? ? WWPDB D_1000036735 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-T2216 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2G64 _pdbx_database_status.recvd_initial_deposition_date 2006-02-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wengerter, B.C.' 1 ? 'Patskovsky, Y.' 2 ? 'Zhan, C.' 3 ? 'Ramagopal, U.' 4 ? 'Milstein, S.' 5 ? 'Vidal, M.' 6 ? 'Almo, S.C.' 7 ? 'Burley, S.K.' 8 0000-0002-2487-9713 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 9 ? # _citation.id primary _citation.title 'Crystal Structure of Caenorhabditis Elegans 6-Pyruvoyl Tetrahydropterin Synthase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wengerter, B.C.' 1 ? primary 'Patskovsky, Y.' 2 ? primary 'Zhan, C.' 3 ? primary 'Ramagopal, U.' 4 ? primary 'Milstein, S.' 5 ? primary 'Vidal, M.' 6 ? primary 'Almo, S.C.' 7 ? # _cell.entry_id 2G64 _cell.length_a 69.792 _cell.length_b 69.792 _cell.length_c 160.188 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2G64 _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative 6-pyruvoyl tetrahydrobiopterin synthase' 16055.360 1 4.2.3.12 C140S ? ? 2 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 167 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PTPS, PTP synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAKLKKEMSLVLD TVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEETPKNIFTYKGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAKLKKEMSLVLD TVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEETPKNIFTYKGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-T2216 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 ARG n 1 4 MET n 1 5 PRO n 1 6 ILE n 1 7 VAL n 1 8 THR n 1 9 MET n 1 10 GLU n 1 11 ARG n 1 12 VAL n 1 13 ASP n 1 14 SER n 1 15 PHE n 1 16 SER n 1 17 ALA n 1 18 ALA n 1 19 HIS n 1 20 ARG n 1 21 LEU n 1 22 HIS n 1 23 SER n 1 24 GLU n 1 25 LYS n 1 26 LEU n 1 27 SER n 1 28 ASP n 1 29 ALA n 1 30 GLU n 1 31 ASN n 1 32 LYS n 1 33 GLU n 1 34 THR n 1 35 PHE n 1 36 GLY n 1 37 LYS n 1 38 CYS n 1 39 ASN n 1 40 ASN n 1 41 SER n 1 42 ASN n 1 43 GLY n 1 44 HIS n 1 45 GLY n 1 46 HIS n 1 47 ASN n 1 48 TYR n 1 49 VAL n 1 50 TRP n 1 51 LYS n 1 52 VAL n 1 53 LYS n 1 54 LEU n 1 55 ARG n 1 56 GLY n 1 57 GLU n 1 58 VAL n 1 59 ASP n 1 60 PRO n 1 61 THR n 1 62 SER n 1 63 GLY n 1 64 MET n 1 65 VAL n 1 66 TYR n 1 67 ASP n 1 68 LEU n 1 69 ALA n 1 70 LYS n 1 71 LEU n 1 72 LYS n 1 73 LYS n 1 74 GLU n 1 75 MET n 1 76 SER n 1 77 LEU n 1 78 VAL n 1 79 LEU n 1 80 ASP n 1 81 THR n 1 82 VAL n 1 83 ASP n 1 84 HIS n 1 85 ARG n 1 86 ASN n 1 87 LEU n 1 88 ASP n 1 89 LYS n 1 90 ASP n 1 91 VAL n 1 92 GLU n 1 93 PHE n 1 94 PHE n 1 95 LYS n 1 96 THR n 1 97 THR n 1 98 VAL n 1 99 SER n 1 100 THR n 1 101 SER n 1 102 GLU n 1 103 ASN n 1 104 VAL n 1 105 ALA n 1 106 ILE n 1 107 TYR n 1 108 MET n 1 109 PHE n 1 110 GLU n 1 111 LYS n 1 112 LEU n 1 113 LYS n 1 114 SER n 1 115 VAL n 1 116 MET n 1 117 SER n 1 118 ASN n 1 119 PRO n 1 120 SER n 1 121 VAL n 1 122 LEU n 1 123 TYR n 1 124 LYS n 1 125 VAL n 1 126 THR n 1 127 ILE n 1 128 GLU n 1 129 GLU n 1 130 THR n 1 131 PRO n 1 132 LYS n 1 133 ASN n 1 134 ILE n 1 135 PHE n 1 136 THR n 1 137 TYR n 1 138 LYS n 1 139 GLY n 1 140 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Caenorhabditis _entity_src_gen.pdbx_gene_src_gene B0041.6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 AI' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTPS_CAEEL _struct_ref.pdbx_db_accession O02058 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAKLKKEMSLVLD TVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEETPKNIFTYKGC ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2G64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O02058 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2G64 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 140 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O02058 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 140 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 140 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2G64 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_percent_sol 47.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.00 _exptl_crystal_grow.pdbx_details '100 MM HEPES, 1 M SODIUM SUCCINATE, PH 7.00, 1% PEG 2000ME, VAPOR DIFFUSION, SITTING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2006-01-31 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator MIRRORS _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 2G64 _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F 0.000 _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.800 _reflns.number_obs 14091 _reflns.number_all 14091 _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs 0.031 _reflns.pdbx_Rsym_value 0.03 _reflns.pdbx_netI_over_sigmaI 38.9000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.400 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs 0.094 _reflns_shell.pdbx_Rsym_value 0.103 _reflns_shell.meanI_over_sigI_obs 14.600 _reflns_shell.pdbx_redundancy 5.20 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1380 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2G64 _refine.ls_number_reflns_obs 13641 _refine.ls_number_reflns_all 13641 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 98.70 _refine.ls_R_factor_obs 0.16238 _refine.ls_R_factor_all 0.163 _refine.ls_R_factor_R_work 0.16058 _refine.ls_R_factor_R_free 0.21902 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.1 _refine.ls_number_reflns_R_free 442 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.B_iso_mean 22.347 _refine.aniso_B[1][1] 0.11 _refine.aniso_B[2][2] 0.11 _refine.aniso_B[3][3] -0.16 _refine.aniso_B[1][2] 0.05 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 1B66 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.120 _refine.pdbx_overall_ESU_R_Free 0.126 _refine.overall_SU_ML 0.081 _refine.overall_SU_B 2.541 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2G64 _refine_analyze.Luzzati_coordinate_error_obs 0.171 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1124 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 167 _refine_hist.number_atoms_total 1300 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 1226 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.251 1.965 ? 1666 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.227 5.000 ? 163 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.923 24.340 ? 53 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.944 15.000 ? 246 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 23.580 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.113 0.200 ? 189 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 903 'X-RAY DIFFRACTION' ? r_nbd_refined 0.232 0.300 ? 560 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.310 0.500 ? 833 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.189 0.500 ? 233 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.193 0.500 ? 1 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.187 0.300 ? 89 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.280 0.500 ? 33 'X-RAY DIFFRACTION' ? r_mcbond_it 4.136 2.000 ? 737 'X-RAY DIFFRACTION' ? r_mcangle_it 5.346 3.000 ? 1217 'X-RAY DIFFRACTION' ? r_scbond_it 9.172 3.000 ? 499 'X-RAY DIFFRACTION' ? r_scangle_it 10.877 5.000 ? 436 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_R_work 981 _refine_ls_shell.R_factor_R_work 0.208 _refine_ls_shell.percent_reflns_obs 97.40 _refine_ls_shell.R_factor_R_free 0.333 _refine_ls_shell.R_factor_R_free_error 0.02 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 981 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2G64 _struct.title 'Structure of Caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2G64 _struct_keywords.pdbx_keywords LYASE _struct_keywords.text ;TETRAHYDROBIOPTERIN BIOSYNTHESIS, PHOSPHATE ELIMINATION, PTERINE SYNTHESIS, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Lyase ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 27 ? GLY A 36 ? SER A 27 GLY A 36 1 ? 10 HELX_P HELX_P2 2 LYS A 37 ? ASN A 40 ? LYS A 37 ASN A 40 5 ? 4 HELX_P HELX_P3 3 ASP A 67 ? THR A 81 ? ASP A 67 THR A 81 1 ? 15 HELX_P HELX_P4 4 LEU A 87 ? VAL A 91 ? LEU A 87 VAL A 91 1 ? 5 HELX_P HELX_P5 5 GLU A 92 ? THR A 96 ? GLU A 92 THR A 96 5 ? 5 HELX_P HELX_P6 6 THR A 100 ? MET A 116 ? THR A 100 MET A 116 1 ? 17 HELX_P HELX_P7 7 ASN A 118 ? SER A 120 ? ASN A 118 SER A 120 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 19 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 19 A ZN 2001 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc2 metalc ? ? A CYS 38 O ? ? ? 1_555 C NA . NA ? ? A CYS 38 A NA 1002 1_555 ? ? ? ? ? ? ? 2.731 ? ? metalc3 metalc ? ? A ASN 40 O ? ? ? 1_555 C NA . NA ? ? A ASN 40 A NA 1002 1_555 ? ? ? ? ? ? ? 2.833 ? ? metalc4 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 C NA . NA ? ? A HIS 44 A NA 1002 1_555 ? ? ? ? ? ? ? 2.867 ? ? metalc5 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 44 A ZN 2001 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc6 metalc ? ? A HIS 46 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 46 A ZN 2001 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc7 metalc ? ? A ASN 47 O ? ? ? 1_555 B NA . NA ? ? A ASN 47 A NA 1001 1_555 ? ? ? ? ? ? ? 2.986 ? ? metalc8 metalc ? ? B NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 1001 A HOH 3019 1_555 ? ? ? ? ? ? ? 2.652 ? ? metalc9 metalc ? ? B NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 1001 A HOH 3117 1_555 ? ? ? ? ? ? ? 2.777 ? ? metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 2001 A HOH 3084 11_566 ? ? ? ? ? ? ? 2.727 ? ? metalc11 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 2001 A HOH 3139 1_555 ? ? ? ? ? ? ? 1.827 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 85 ? ASN A 86 ? ARG A 85 ASN A 86 A 2 ILE A 6 ? HIS A 19 ? ILE A 6 HIS A 19 A 3 HIS A 44 ? GLU A 57 ? HIS A 44 GLU A 57 A 4 LEU A 122 ? THR A 130 ? LEU A 122 THR A 130 A 5 ASN A 133 ? TYR A 137 ? ASN A 133 TYR A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 85 ? O ARG A 85 N ALA A 18 ? N ALA A 18 A 2 3 N MET A 9 ? N MET A 9 O LEU A 54 ? O LEU A 54 A 3 4 N LYS A 53 ? N LYS A 53 O LYS A 124 ? O LYS A 124 A 4 5 N ILE A 127 ? N ILE A 127 O PHE A 135 ? O PHE A 135 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 1001 ? 7 'BINDING SITE FOR RESIDUE NA A 1001' AC2 Software A NA 1002 ? 5 'BINDING SITE FOR RESIDUE NA A 1002' AC3 Software A ZN 2001 ? 5 'BINDING SITE FOR RESIDUE ZN A 2001' AC4 Software A GOL 3001 ? 5 'BINDING SITE FOR RESIDUE GOL A 3001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASN A 47 ? ASN A 47 . ? 1_555 ? 2 AC1 7 GLU A 128 ? GLU A 128 . ? 1_555 ? 3 AC1 7 GLU A 129 ? GLU A 129 . ? 1_555 ? 4 AC1 7 THR A 130 ? THR A 130 . ? 1_555 ? 5 AC1 7 PRO A 131 ? PRO A 131 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 3019 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 3117 . ? 1_555 ? 8 AC2 5 ARG A 20 ? ARG A 20 . ? 1_555 ? 9 AC2 5 CYS A 38 ? CYS A 38 . ? 1_555 ? 10 AC2 5 ASN A 40 ? ASN A 40 . ? 1_555 ? 11 AC2 5 GLY A 43 ? GLY A 43 . ? 1_555 ? 12 AC2 5 HIS A 44 ? HIS A 44 . ? 1_555 ? 13 AC3 5 HIS A 19 ? HIS A 19 . ? 1_555 ? 14 AC3 5 HIS A 44 ? HIS A 44 . ? 1_555 ? 15 AC3 5 HIS A 46 ? HIS A 46 . ? 1_555 ? 16 AC3 5 HOH F . ? HOH A 3084 . ? 11_566 ? 17 AC3 5 HOH F . ? HOH A 3139 . ? 1_555 ? 18 AC4 5 LYS A 53 ? LYS A 53 . ? 1_555 ? 19 AC4 5 TYR A 123 ? TYR A 123 . ? 1_555 ? 20 AC4 5 LYS A 124 ? LYS A 124 . ? 1_555 ? 21 AC4 5 HOH F . ? HOH A 3116 . ? 2_665 ? 22 AC4 5 HOH F . ? HOH A 3121 . ? 1_555 ? # _database_PDB_matrix.entry_id 2G64 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2G64 _atom_sites.fract_transf_matrix[1][1] 0.014328 _atom_sites.fract_transf_matrix[1][2] 0.008272 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016545 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006243 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 SER 140 140 140 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 1001 1 NA NA A . C 2 NA 1 1002 2 NA NA A . D 3 ZN 1 2001 1 ZN ZN A . E 4 GOL 1 3001 1 GOL GOL A . F 5 HOH 1 3002 3 HOH HOH A . F 5 HOH 2 3003 4 HOH HOH A . F 5 HOH 3 3004 5 HOH HOH A . F 5 HOH 4 3005 6 HOH HOH A . F 5 HOH 5 3006 7 HOH HOH A . F 5 HOH 6 3007 8 HOH HOH A . F 5 HOH 7 3008 9 HOH HOH A . F 5 HOH 8 3009 10 HOH HOH A . F 5 HOH 9 3010 12 HOH HOH A . F 5 HOH 10 3011 13 HOH HOH A . F 5 HOH 11 3012 14 HOH HOH A . F 5 HOH 12 3013 15 HOH HOH A . F 5 HOH 13 3014 16 HOH HOH A . F 5 HOH 14 3015 18 HOH HOH A . F 5 HOH 15 3016 19 HOH HOH A . F 5 HOH 16 3017 20 HOH HOH A . F 5 HOH 17 3018 21 HOH HOH A . F 5 HOH 18 3019 22 HOH HOH A . F 5 HOH 19 3020 23 HOH HOH A . F 5 HOH 20 3021 24 HOH HOH A . F 5 HOH 21 3022 25 HOH HOH A . F 5 HOH 22 3023 26 HOH HOH A . F 5 HOH 23 3024 27 HOH HOH A . F 5 HOH 24 3025 28 HOH HOH A . F 5 HOH 25 3026 29 HOH HOH A . F 5 HOH 26 3027 30 HOH HOH A . F 5 HOH 27 3028 31 HOH HOH A . F 5 HOH 28 3029 32 HOH HOH A . F 5 HOH 29 3030 33 HOH HOH A . F 5 HOH 30 3031 34 HOH HOH A . F 5 HOH 31 3032 35 HOH HOH A . F 5 HOH 32 3033 36 HOH HOH A . F 5 HOH 33 3034 38 HOH HOH A . F 5 HOH 34 3035 39 HOH HOH A . F 5 HOH 35 3036 40 HOH HOH A . F 5 HOH 36 3037 42 HOH HOH A . F 5 HOH 37 3038 43 HOH HOH A . F 5 HOH 38 3039 44 HOH HOH A . F 5 HOH 39 3040 45 HOH HOH A . F 5 HOH 40 3041 46 HOH HOH A . F 5 HOH 41 3042 47 HOH HOH A . F 5 HOH 42 3043 49 HOH HOH A . F 5 HOH 43 3044 50 HOH HOH A . F 5 HOH 44 3045 51 HOH HOH A . F 5 HOH 45 3046 52 HOH HOH A . F 5 HOH 46 3047 53 HOH HOH A . F 5 HOH 47 3048 54 HOH HOH A . F 5 HOH 48 3049 56 HOH HOH A . F 5 HOH 49 3050 57 HOH HOH A . F 5 HOH 50 3051 58 HOH HOH A . F 5 HOH 51 3052 59 HOH HOH A . F 5 HOH 52 3053 60 HOH HOH A . F 5 HOH 53 3054 61 HOH HOH A . F 5 HOH 54 3055 62 HOH HOH A . F 5 HOH 55 3056 63 HOH HOH A . F 5 HOH 56 3057 64 HOH HOH A . F 5 HOH 57 3058 65 HOH HOH A . F 5 HOH 58 3059 67 HOH HOH A . F 5 HOH 59 3060 69 HOH HOH A . F 5 HOH 60 3061 70 HOH HOH A . F 5 HOH 61 3062 71 HOH HOH A . F 5 HOH 62 3063 72 HOH HOH A . F 5 HOH 63 3064 73 HOH HOH A . F 5 HOH 64 3065 74 HOH HOH A . F 5 HOH 65 3066 75 HOH HOH A . F 5 HOH 66 3067 76 HOH HOH A . F 5 HOH 67 3068 77 HOH HOH A . F 5 HOH 68 3069 78 HOH HOH A . F 5 HOH 69 3070 79 HOH HOH A . F 5 HOH 70 3071 80 HOH HOH A . F 5 HOH 71 3072 81 HOH HOH A . F 5 HOH 72 3073 83 HOH HOH A . F 5 HOH 73 3074 84 HOH HOH A . F 5 HOH 74 3075 85 HOH HOH A . F 5 HOH 75 3076 86 HOH HOH A . F 5 HOH 76 3077 91 HOH HOH A . F 5 HOH 77 3078 93 HOH HOH A . F 5 HOH 78 3079 94 HOH HOH A . F 5 HOH 79 3080 95 HOH HOH A . F 5 HOH 80 3081 96 HOH HOH A . F 5 HOH 81 3082 97 HOH HOH A . F 5 HOH 82 3083 98 HOH HOH A . F 5 HOH 83 3084 99 HOH HOH A . F 5 HOH 84 3085 100 HOH HOH A . F 5 HOH 85 3086 101 HOH HOH A . F 5 HOH 86 3087 102 HOH HOH A . F 5 HOH 87 3088 103 HOH HOH A . F 5 HOH 88 3089 104 HOH HOH A . F 5 HOH 89 3090 105 HOH HOH A . F 5 HOH 90 3091 106 HOH HOH A . F 5 HOH 91 3092 107 HOH HOH A . F 5 HOH 92 3093 108 HOH HOH A . F 5 HOH 93 3094 109 HOH HOH A . F 5 HOH 94 3095 110 HOH HOH A . F 5 HOH 95 3096 111 HOH HOH A . F 5 HOH 96 3097 112 HOH HOH A . F 5 HOH 97 3098 113 HOH HOH A . F 5 HOH 98 3099 114 HOH HOH A . F 5 HOH 99 3100 115 HOH HOH A . F 5 HOH 100 3101 116 HOH HOH A . F 5 HOH 101 3102 117 HOH HOH A . F 5 HOH 102 3103 118 HOH HOH A . F 5 HOH 103 3104 119 HOH HOH A . F 5 HOH 104 3105 120 HOH HOH A . F 5 HOH 105 3106 121 HOH HOH A . F 5 HOH 106 3107 122 HOH HOH A . F 5 HOH 107 3108 124 HOH HOH A . F 5 HOH 108 3109 125 HOH HOH A . F 5 HOH 109 3110 126 HOH HOH A . F 5 HOH 110 3111 127 HOH HOH A . F 5 HOH 111 3112 128 HOH HOH A . F 5 HOH 112 3113 129 HOH HOH A . F 5 HOH 113 3114 130 HOH HOH A . F 5 HOH 114 3115 131 HOH HOH A . F 5 HOH 115 3116 136 HOH HOH A . F 5 HOH 116 3117 138 HOH HOH A . F 5 HOH 117 3118 139 HOH HOH A . F 5 HOH 118 3119 2 HOH HOH A . F 5 HOH 119 3120 3 HOH HOH A . F 5 HOH 120 3121 4 HOH HOH A . F 5 HOH 121 3122 5 HOH HOH A . F 5 HOH 122 3123 6 HOH HOH A . F 5 HOH 123 3124 7 HOH HOH A . F 5 HOH 124 3125 8 HOH HOH A . F 5 HOH 125 3126 9 HOH HOH A . F 5 HOH 126 3127 10 HOH HOH A . F 5 HOH 127 3128 11 HOH HOH A . F 5 HOH 128 3129 12 HOH HOH A . F 5 HOH 129 3130 13 HOH HOH A . F 5 HOH 130 3131 14 HOH HOH A . F 5 HOH 131 3132 15 HOH HOH A . F 5 HOH 132 3133 16 HOH HOH A . F 5 HOH 133 3134 17 HOH HOH A . F 5 HOH 134 3135 18 HOH HOH A . F 5 HOH 135 3136 19 HOH HOH A . F 5 HOH 136 3137 20 HOH HOH A . F 5 HOH 137 3138 21 HOH HOH A . F 5 HOH 138 3139 22 HOH HOH A . F 5 HOH 139 3140 23 HOH HOH A . F 5 HOH 140 3141 24 HOH HOH A . F 5 HOH 141 3142 25 HOH HOH A . F 5 HOH 142 3143 26 HOH HOH A . F 5 HOH 143 3144 27 HOH HOH A . F 5 HOH 144 3145 28 HOH HOH A . F 5 HOH 145 3146 29 HOH HOH A . F 5 HOH 146 3147 30 HOH HOH A . F 5 HOH 147 3148 31 HOH HOH A . F 5 HOH 148 3149 32 HOH HOH A . F 5 HOH 149 3150 33 HOH HOH A . F 5 HOH 150 3151 34 HOH HOH A . F 5 HOH 151 3152 35 HOH HOH A . F 5 HOH 152 3153 36 HOH HOH A . F 5 HOH 153 3154 37 HOH HOH A . F 5 HOH 154 3155 38 HOH HOH A . F 5 HOH 155 3156 39 HOH HOH A . F 5 HOH 156 3157 40 HOH HOH A . F 5 HOH 157 3158 41 HOH HOH A . F 5 HOH 158 3159 42 HOH HOH A . F 5 HOH 159 3160 43 HOH HOH A . F 5 HOH 160 3161 44 HOH HOH A . F 5 HOH 161 3162 45 HOH HOH A . F 5 HOH 162 3163 46 HOH HOH A . F 5 HOH 163 3164 47 HOH HOH A . F 5 HOH 164 3165 48 HOH HOH A . F 5 HOH 165 3166 49 HOH HOH A . F 5 HOH 166 3167 50 HOH HOH A . F 5 HOH 167 3168 51 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14840 ? 1 MORE -352 ? 1 'SSA (A^2)' 37860 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 34.8960000000 0.8660254038 -0.5000000000 0.0000000000 60.4416449809 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -34.8960000000 -0.8660254038 -0.5000000000 0.0000000000 60.4416449809 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_456 y-1/3,x+1/3,-z+4/3 -0.5000000000 0.8660254038 0.0000000000 -34.8960000000 0.8660254038 0.5000000000 0.0000000000 20.1472149936 0.0000000000 0.0000000000 -1.0000000000 213.5840000000 5 'crystal symmetry operation' 11_566 x-y+2/3,-y+4/3,-z+4/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 80.5888599746 0.0000000000 0.0000000000 -1.0000000000 213.5840000000 6 'crystal symmetry operation' 12_556 -x+2/3,-x+y+1/3,-z+4/3 -0.5000000000 -0.8660254038 0.0000000000 34.8960000000 -0.8660254038 0.5000000000 0.0000000000 20.1472149936 0.0000000000 0.0000000000 -1.0000000000 213.5840000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 93.9 ? 2 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 111.5 ? 3 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 109.3 ? 4 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3084 ? 11_566 166.5 ? 5 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3084 ? 11_566 83.7 ? 6 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3084 ? 11_566 81.7 ? 7 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3139 ? 1_555 109.0 ? 8 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3139 ? 1_555 111.5 ? 9 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3139 ? 1_555 118.8 ? 10 O ? F HOH . ? A HOH 3084 ? 11_566 ZN ? D ZN . ? A ZN 2001 ? 1_555 O ? F HOH . ? A HOH 3139 ? 1_555 60.2 ? 11 O ? A CYS 38 ? A CYS 38 ? 1_555 NA ? C NA . ? A NA 1002 ? 1_555 O ? A ASN 40 ? A ASN 40 ? 1_555 111.6 ? 12 O ? A CYS 38 ? A CYS 38 ? 1_555 NA ? C NA . ? A NA 1002 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 86.6 ? 13 O ? A ASN 40 ? A ASN 40 ? 1_555 NA ? C NA . ? A NA 1002 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 159.9 ? 14 O ? A ASN 47 ? A ASN 47 ? 1_555 NA ? B NA . ? A NA 1001 ? 1_555 O ? F HOH . ? A HOH 3019 ? 1_555 150.6 ? 15 O ? A ASN 47 ? A ASN 47 ? 1_555 NA ? B NA . ? A NA 1001 ? 1_555 O ? F HOH . ? A HOH 3117 ? 1_555 69.9 ? 16 O ? F HOH . ? A HOH 3019 ? 1_555 NA ? B NA . ? A NA 1001 ? 1_555 O ? F HOH . ? A HOH 3117 ? 1_555 106.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-14 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 5 'Structure model' 1 4 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_site 5 5 'Structure model' database_2 6 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_symmetry' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 26 5 'Structure model' '_database_2.pdbx_DOI' 27 5 'Structure model' '_database_2.pdbx_database_accession' 28 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 MOLREP phasing . ? 3 REFMAC refinement 5.2.0005 ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 99 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -85.25 _pdbx_validate_torsion.psi 39.95 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'ZINC ION' ZN 4 GLYCEROL GOL 5 water HOH #