data_2GJH # _entry.id 2GJH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GJH pdb_00002gjh 10.2210/pdb2gjh/pdb RCSB RCSB037194 ? ? WWPDB D_1000037194 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-17 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GJH _pdbx_database_status.recvd_initial_deposition_date 2006-03-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Dantas, G.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Mis-translation of a Computationally Designed Protein Yields an Exceptionally Stable Homodimer: Implications for Protein Engineering and Evolution. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 362 _citation.page_first 1004 _citation.page_last 1024 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16949611 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.07.092 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dantas, G.' 1 ? primary 'Watters, A.L.' 2 ? primary 'Lunde, B.M.' 3 ? primary 'Eletr, Z.M.' 4 ? primary 'Isern, N.G.' 5 ? primary 'Roseman, T.' 6 ? primary 'Lipfert, J.' 7 ? primary 'Doniach, S.' 8 ? primary 'Tompa, M.' 9 ? primary 'Kuhlman, B.' 10 ? primary 'Stoddard, B.L.' 11 ? primary 'Varani, G.' 12 ? primary 'Baker, D.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DESIGNED PROTEIN' _entity.formula_weight 7049.915 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MERVRISITARTKKEAEKFAAILIKVFAELGYNDINVTWDGDTVTVEGQLEGGSLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MERVRISITARTKKEAEKFAAILIKVFAELGYNDINVTWDGDTVTVEGQLEGGSLEHHHHHH _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 VAL n 1 5 ARG n 1 6 ILE n 1 7 SER n 1 8 ILE n 1 9 THR n 1 10 ALA n 1 11 ARG n 1 12 THR n 1 13 LYS n 1 14 LYS n 1 15 GLU n 1 16 ALA n 1 17 GLU n 1 18 LYS n 1 19 PHE n 1 20 ALA n 1 21 ALA n 1 22 ILE n 1 23 LEU n 1 24 ILE n 1 25 LYS n 1 26 VAL n 1 27 PHE n 1 28 ALA n 1 29 GLU n 1 30 LEU n 1 31 GLY n 1 32 TYR n 1 33 ASN n 1 34 ASP n 1 35 ILE n 1 36 ASN n 1 37 VAL n 1 38 THR n 1 39 TRP n 1 40 ASP n 1 41 GLY n 1 42 ASP n 1 43 THR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 GLU n 1 48 GLY n 1 49 GLN n 1 50 LEU n 1 51 GLU n 1 52 GLY n 1 53 GLY n 1 54 SER n 1 55 LEU n 1 56 GLU n 1 57 HIS n 1 58 HIS n 1 59 HIS n 1 60 HIS n 1 61 HIS n 1 62 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name ? _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 29b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 HIS 59 59 ? ? ? A . n A 1 60 HIS 60 60 ? ? ? A . n A 1 61 HIS 61 61 ? ? ? A . n A 1 62 HIS 62 62 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 GLU 2 2 102 GLU GLU B . n B 1 3 ARG 3 3 103 ARG ARG B . n B 1 4 VAL 4 4 104 VAL VAL B . n B 1 5 ARG 5 5 105 ARG ARG B . n B 1 6 ILE 6 6 106 ILE ILE B . n B 1 7 SER 7 7 107 SER SER B . n B 1 8 ILE 8 8 108 ILE ILE B . n B 1 9 THR 9 9 109 THR THR B . n B 1 10 ALA 10 10 110 ALA ALA B . n B 1 11 ARG 11 11 111 ARG ARG B . n B 1 12 THR 12 12 112 THR THR B . n B 1 13 LYS 13 13 113 LYS LYS B . n B 1 14 LYS 14 14 114 LYS LYS B . n B 1 15 GLU 15 15 115 GLU GLU B . n B 1 16 ALA 16 16 116 ALA ALA B . n B 1 17 GLU 17 17 117 GLU GLU B . n B 1 18 LYS 18 18 118 LYS LYS B . n B 1 19 PHE 19 19 119 PHE PHE B . n B 1 20 ALA 20 20 120 ALA ALA B . n B 1 21 ALA 21 21 121 ALA ALA B . n B 1 22 ILE 22 22 122 ILE ILE B . n B 1 23 LEU 23 23 123 LEU LEU B . n B 1 24 ILE 24 24 124 ILE ILE B . n B 1 25 LYS 25 25 125 LYS LYS B . n B 1 26 VAL 26 26 126 VAL VAL B . n B 1 27 PHE 27 27 127 PHE PHE B . n B 1 28 ALA 28 28 128 ALA ALA B . n B 1 29 GLU 29 29 129 GLU GLU B . n B 1 30 LEU 30 30 130 LEU LEU B . n B 1 31 GLY 31 31 131 GLY GLY B . n B 1 32 TYR 32 32 132 TYR TYR B . n B 1 33 ASN 33 33 133 ASN ASN B . n B 1 34 ASP 34 34 134 ASP ASP B . n B 1 35 ILE 35 35 135 ILE ILE B . n B 1 36 ASN 36 36 136 ASN ASN B . n B 1 37 VAL 37 37 137 VAL VAL B . n B 1 38 THR 38 38 138 THR THR B . n B 1 39 TRP 39 39 139 TRP TRP B . n B 1 40 ASP 40 40 140 ASP ASP B . n B 1 41 GLY 41 41 141 GLY GLY B . n B 1 42 ASP 42 42 142 ASP ASP B . n B 1 43 THR 43 43 143 THR THR B . n B 1 44 VAL 44 44 144 VAL VAL B . n B 1 45 THR 45 45 145 THR THR B . n B 1 46 VAL 46 46 146 VAL VAL B . n B 1 47 GLU 47 47 147 GLU GLU B . n B 1 48 GLY 48 48 148 GLY GLY B . n B 1 49 GLN 49 49 149 GLN GLN B . n B 1 50 LEU 50 50 150 LEU LEU B . n B 1 51 GLU 51 51 151 GLU GLU B . n B 1 52 GLY 52 52 152 GLY GLY B . n B 1 53 GLY 53 53 153 GLY GLY B . n B 1 54 SER 54 54 154 SER SER B . n B 1 55 LEU 55 55 155 LEU LEU B . n B 1 56 GLU 56 56 156 GLU GLU B . n B 1 57 HIS 57 57 157 HIS HIS B . n B 1 58 HIS 58 58 158 HIS HIS B . n B 1 59 HIS 59 59 ? ? ? B . n B 1 60 HIS 60 60 ? ? ? B . n B 1 61 HIS 61 61 ? ? ? B . n B 1 62 HIS 62 62 ? ? ? B . n # _cell.entry_id 2GJH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2GJH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2GJH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2GJH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2GJH _struct.title 'NMR Structure of CFr (C-terminal fragment of computationally designed novel-topology protein Top7)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GJH _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Obligate symmetric homo-dimer, DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 2GJH _struct_ref.pdbx_db_accession 2GJH _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2GJH A 1 ? 62 ? 2GJH 1 ? 62 ? 1 62 2 1 2GJH B 1 ? 62 ? 2GJH 1 ? 62 ? 1 62 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 12 ? LEU A 30 ? THR A 12 LEU A 30 1 ? 19 HELX_P HELX_P2 2 THR B 12 ? LEU B 30 ? THR B 12 LEU B 30 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 36 ? TRP A 39 ? ASN A 36 TRP A 39 A 2 VAL A 44 ? GLN A 49 ? VAL A 44 GLN A 49 A 3 ARG A 3 ? THR A 9 ? ARG A 3 THR A 9 A 4 ARG B 3 ? THR B 9 ? ARG B 3 THR B 9 A 5 VAL B 44 ? GLN B 49 ? VAL B 44 GLN B 49 A 6 ASN B 36 ? TRP B 39 ? ASN B 36 TRP B 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 36 ? N ASN A 36 O GLU A 47 ? O GLU A 47 A 2 3 O VAL A 46 ? O VAL A 46 N ILE A 6 ? N ILE A 6 A 3 4 N SER A 7 ? N SER A 7 O SER B 7 ? O SER B 7 A 4 5 N ILE B 6 ? N ILE B 6 O VAL B 46 ? O VAL B 46 A 5 6 O GLU B 47 ? O GLU B 47 N ASN B 36 ? N ASN B 36 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 32 ? ? -94.29 35.68 2 1 ASN A 33 ? ? -49.89 161.08 3 1 ASP A 34 ? ? 68.75 62.67 4 1 ASP A 42 ? ? -149.25 21.09 5 1 SER A 54 ? ? 63.30 161.27 6 1 GLU A 56 ? ? -67.59 -170.04 7 1 TYR B 32 ? ? -94.81 34.68 8 1 ASP B 34 ? ? 70.60 58.20 9 1 ASP B 42 ? ? -149.14 18.47 10 1 LEU B 55 ? ? -109.13 65.62 11 1 HIS B 57 ? ? -179.30 132.59 12 2 TYR A 32 ? ? -94.84 35.58 13 2 ASP A 34 ? ? 71.02 58.83 14 2 ASP A 42 ? ? -147.06 19.93 15 2 HIS A 57 ? ? -179.32 112.22 16 2 TYR B 32 ? ? -94.60 30.73 17 2 ASP B 34 ? ? 70.09 56.78 18 2 ASP B 42 ? ? -141.15 12.49 19 2 GLU B 56 ? ? -169.31 -169.94 20 2 HIS B 57 ? ? -175.01 144.53 21 3 TYR A 32 ? ? -93.90 34.62 22 3 ASP A 34 ? ? 70.23 57.80 23 3 TYR B 32 ? ? -93.84 34.90 24 3 ASP B 34 ? ? 71.55 57.53 25 3 ASP B 42 ? ? -146.31 18.59 26 3 LEU B 55 ? ? -109.60 -64.44 27 3 HIS B 57 ? ? -179.17 139.45 28 4 TYR A 32 ? ? -94.69 35.21 29 4 ASP A 34 ? ? 70.73 59.59 30 4 HIS A 57 ? ? -179.49 125.62 31 4 TYR B 32 ? ? -94.69 35.71 32 4 ASN B 33 ? ? -49.80 161.57 33 4 ASP B 34 ? ? 70.55 59.28 34 4 ASP B 42 ? ? -146.95 18.52 35 4 HIS B 57 ? ? -179.27 146.88 36 5 TYR A 32 ? ? -94.07 36.39 37 5 ASN A 33 ? ? -49.04 161.54 38 5 ASP A 34 ? ? 70.31 57.64 39 5 ASP A 42 ? ? -153.95 21.64 40 5 THR B 9 ? ? -101.35 73.53 41 5 TYR B 32 ? ? -94.37 36.56 42 5 ASN B 33 ? ? -49.23 161.37 43 5 ASP B 34 ? ? 70.53 58.05 44 5 ASP B 42 ? ? -150.10 18.48 45 5 GLU B 51 ? ? -97.06 34.44 46 6 THR A 9 ? ? -103.66 75.95 47 6 TYR A 32 ? ? -94.67 33.68 48 6 ASP A 34 ? ? 71.26 61.28 49 6 HIS A 57 ? ? -179.37 149.53 50 6 THR B 9 ? ? -103.77 74.63 51 6 TYR B 32 ? ? -94.37 35.41 52 6 ASN B 33 ? ? -49.94 161.54 53 6 ASP B 34 ? ? 70.55 59.17 54 6 ASP B 42 ? ? -150.48 19.56 55 6 LEU B 55 ? ? -86.72 -70.25 56 6 HIS B 57 ? ? -176.90 34.14 57 7 TYR A 32 ? ? -94.66 34.87 58 7 ASP A 34 ? ? 70.31 57.98 59 7 ASP A 42 ? ? -151.89 20.90 60 7 GLU A 56 ? ? -61.64 -169.98 61 7 HIS A 57 ? ? -179.25 104.25 62 7 THR B 9 ? ? -102.58 74.06 63 7 ARG B 11 ? ? -80.45 -71.49 64 7 TYR B 32 ? ? -94.25 35.79 65 7 ASN B 33 ? ? -49.61 160.98 66 7 ASP B 34 ? ? 68.52 64.79 67 7 ASP B 42 ? ? -149.59 18.23 68 7 SER B 54 ? ? -160.85 -40.93 69 7 GLU B 56 ? ? -172.23 -170.07 70 7 HIS B 57 ? ? -174.98 44.06 71 8 TYR A 32 ? ? -94.66 34.98 72 8 ASN A 33 ? ? -49.84 161.52 73 8 ASP A 34 ? ? 70.42 56.09 74 8 ASP A 42 ? ? -147.58 18.81 75 8 TYR B 32 ? ? -94.73 35.11 76 8 ASP B 34 ? ? 70.61 58.68 77 8 SER B 54 ? ? -154.58 -63.88 78 8 HIS B 57 ? ? -179.13 143.10 79 9 TYR A 32 ? ? -94.59 34.32 80 9 ASP A 34 ? ? 70.55 57.99 81 9 ASP A 42 ? ? -153.41 21.24 82 9 SER A 54 ? ? -161.83 -40.76 83 9 HIS A 57 ? ? -179.29 138.71 84 9 THR B 9 ? ? -102.26 73.68 85 9 TYR B 32 ? ? -94.42 35.04 86 9 ASN B 33 ? ? -49.69 161.47 87 9 ASP B 34 ? ? 70.54 56.34 88 9 ASP B 42 ? ? -149.70 18.25 89 9 GLU B 51 ? ? -99.20 33.82 90 9 SER B 54 ? ? 62.81 101.09 91 9 GLU B 56 ? ? 44.00 -163.55 92 9 HIS B 57 ? ? -179.77 -43.48 93 10 TYR A 32 ? ? -94.31 32.81 94 10 LEU A 55 ? ? -125.91 -69.94 95 10 TYR B 32 ? ? -94.03 33.30 96 10 SER B 54 ? ? -109.81 -60.08 97 10 HIS B 57 ? ? -179.26 122.13 98 11 TYR A 32 ? ? -93.77 34.79 99 11 ASN A 33 ? ? -49.97 161.24 100 11 ASP A 34 ? ? 69.28 64.61 101 11 ASP A 42 ? ? -161.72 26.14 102 11 LEU A 55 ? ? -107.09 -60.07 103 11 HIS A 57 ? ? -179.25 100.86 104 11 TYR B 32 ? ? -94.62 35.48 105 11 ASP B 34 ? ? 70.58 57.12 106 11 ASP B 42 ? ? -149.36 19.79 107 11 SER B 54 ? ? -159.19 -60.99 108 12 TYR A 32 ? ? -94.24 34.90 109 12 ASN A 33 ? ? -49.41 161.92 110 12 ASP A 34 ? ? 71.90 56.29 111 12 ASP A 42 ? ? -144.77 17.22 112 12 SER A 54 ? ? 63.13 161.28 113 12 GLU A 56 ? ? -77.35 -75.59 114 12 HIS A 57 ? ? 51.94 -170.83 115 12 TYR B 32 ? ? -94.34 36.01 116 12 ASN B 33 ? ? -49.59 161.46 117 12 ASP B 34 ? ? 70.45 57.69 118 12 ASP B 42 ? ? -147.14 18.72 119 12 GLU B 51 ? ? -100.27 40.47 120 12 SER B 54 ? ? -121.06 -60.68 121 12 HIS B 57 ? ? -179.40 -58.07 122 13 TYR A 32 ? ? -94.46 33.48 123 13 ASP A 34 ? ? 68.52 61.55 124 13 ASP A 42 ? ? -152.13 20.40 125 13 GLU A 56 ? ? 64.40 154.50 126 13 HIS A 57 ? ? -151.48 -54.90 127 13 TYR B 32 ? ? -94.18 35.93 128 13 ASP B 34 ? ? 71.02 60.45 129 13 GLU B 51 ? ? -92.10 47.28 130 13 SER B 54 ? ? -152.77 -67.10 131 13 HIS B 57 ? ? -179.33 107.73 132 14 TYR A 32 ? ? -94.34 36.24 133 14 ASN A 33 ? ? -49.15 161.21 134 14 ASP A 34 ? ? 69.24 60.80 135 14 ASP A 42 ? ? -151.11 20.44 136 14 SER A 54 ? ? -174.51 -37.04 137 14 GLU A 56 ? ? 44.01 -163.62 138 14 HIS A 57 ? ? -179.75 137.48 139 14 THR B 9 ? ? -101.47 71.52 140 14 TYR B 32 ? ? -93.89 36.77 141 14 ASN B 33 ? ? -49.66 160.44 142 14 ASP B 34 ? ? 67.55 69.25 143 14 ASP B 42 ? ? -148.45 17.62 144 14 GLU B 56 ? ? -120.21 -76.54 145 14 HIS B 57 ? ? 50.79 70.86 146 15 TYR A 32 ? ? -94.64 35.82 147 15 ASN A 33 ? ? -49.73 161.78 148 15 ASP A 34 ? ? 71.04 58.99 149 15 LEU A 55 ? ? -103.58 51.17 150 15 GLU A 56 ? ? -45.33 -75.39 151 15 TYR B 32 ? ? -94.61 34.40 152 15 ASP B 34 ? ? 71.06 57.91 153 15 ASP B 42 ? ? -145.18 21.83 154 15 SER B 54 ? ? 63.14 101.93 155 15 HIS B 57 ? ? -179.45 107.88 156 16 TYR A 32 ? ? -94.35 35.58 157 16 ASN A 33 ? ? -49.42 161.50 158 16 ASP A 34 ? ? 70.67 58.92 159 16 ASP A 42 ? ? -149.80 19.59 160 16 GLU A 56 ? ? -46.24 -78.09 161 16 HIS A 57 ? ? 67.81 -77.33 162 16 TYR B 32 ? ? -94.10 35.84 163 16 ASP B 34 ? ? 67.70 68.92 164 16 SER B 54 ? ? 65.89 117.07 165 16 GLU B 56 ? ? -173.98 -169.99 166 16 HIS B 57 ? ? -179.25 131.97 167 17 TYR A 32 ? ? -94.80 31.22 168 17 ASN A 33 ? ? -48.73 161.05 169 17 ASP A 34 ? ? 68.30 64.11 170 17 ASP A 42 ? ? -151.17 19.91 171 17 HIS A 57 ? ? -179.24 114.80 172 17 TYR B 32 ? ? -94.22 35.84 173 17 ASN B 33 ? ? -49.39 161.00 174 17 ASP B 34 ? ? 69.30 62.94 175 17 ASP B 42 ? ? -153.39 21.09 176 17 LEU B 55 ? ? -155.64 32.02 177 17 GLU B 56 ? ? 64.43 154.49 178 17 HIS B 57 ? ? -176.67 -47.41 179 18 TYR A 32 ? ? -94.83 35.37 180 18 ASP A 34 ? ? 70.86 58.26 181 18 LEU A 55 ? ? -108.66 61.40 182 18 TYR B 32 ? ? -93.63 34.65 183 18 ASP B 34 ? ? 70.87 60.20 184 18 GLU B 56 ? ? -72.19 -169.97 185 19 THR A 9 ? ? -102.23 73.50 186 19 ASN A 33 ? ? -47.05 160.97 187 19 ASP A 34 ? ? 68.71 61.36 188 19 ASP A 42 ? ? -149.75 18.33 189 19 SER A 54 ? ? -163.10 -40.32 190 19 HIS A 57 ? ? 50.20 -168.27 191 19 TYR B 32 ? ? -94.60 30.60 192 19 ASP B 42 ? ? -150.87 19.81 193 19 GLU B 51 ? ? -92.16 44.40 194 19 SER B 54 ? ? -153.48 -65.22 195 19 LEU B 55 ? ? 64.46 -80.61 196 19 GLU B 56 ? ? -141.41 -77.20 197 20 TYR A 32 ? ? -94.19 35.02 198 20 ASP A 34 ? ? 69.80 63.64 199 20 SER A 54 ? ? 62.24 166.54 200 20 GLU A 56 ? ? 64.49 154.32 201 20 THR B 9 ? ? -103.37 73.64 202 20 TYR B 32 ? ? -94.27 36.80 203 20 ASN B 33 ? ? -49.39 161.48 204 20 ASP B 34 ? ? 70.88 59.04 205 20 ASP B 42 ? ? -147.31 17.28 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The protein has been computationally designed. Residues 1, 2, 52-62 were added to the original protein construct to allow for expression and purification, including a C-terminal six residue HIS tag ; # _pdbx_nmr_ensemble.entry_id 2GJH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GJH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM CFr, 25mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1mM CFr, 25mM phosphate buffer, pH 7.0, 100% D2O' '100% D2O' 3 '1.0mM CFr U-15N, 13C, 25mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O' '90% H2O/10% D2O' 4 '1.0mM CFr U-15N, 25mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O' '90% H2O/10% D2O' 5 '1.4mM CFr U-15N, 13C, 1.4mM 14N, 12C CFr, 25mM phosphate buffer, pH 7.0, 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D NOESY' 2 3 1 3D_13C-separated_NOESY 3 4 1 3D_15N-separated_NOESY 4 5 1 3D_13C-filtered_NOESY 5 # _pdbx_nmr_details.entry_id 2GJH _pdbx_nmr_details.text 'Hydrogen bond restraints were derived from D2O protection analysis. Torsion angle restraints were derived from TALOS predictions' # _pdbx_nmr_refine.entry_id 2GJH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.0 'P.Guntert et al.' 1 'structure solution' CYANA 2.0 'P.Guntert et al.' 2 'data analysis' TALOS ? 'G. Cornilescu et al.' 3 processing NMRPipe 2.3 'F. Delaglio et al.' 4 'data analysis' Sparky 3.112 'T. Goddard and D. Kneller' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 59 ? A HIS 59 3 1 Y 1 A HIS 60 ? A HIS 60 4 1 Y 1 A HIS 61 ? A HIS 61 5 1 Y 1 A HIS 62 ? A HIS 62 6 1 Y 1 B MET 1 ? B MET 1 7 1 Y 1 B HIS 59 ? B HIS 59 8 1 Y 1 B HIS 60 ? B HIS 60 9 1 Y 1 B HIS 61 ? B HIS 61 10 1 Y 1 B HIS 62 ? B HIS 62 11 2 Y 1 A MET 1 ? A MET 1 12 2 Y 1 A HIS 59 ? A HIS 59 13 2 Y 1 A HIS 60 ? A HIS 60 14 2 Y 1 A HIS 61 ? A HIS 61 15 2 Y 1 A HIS 62 ? A HIS 62 16 2 Y 1 B MET 1 ? B MET 1 17 2 Y 1 B HIS 59 ? B HIS 59 18 2 Y 1 B HIS 60 ? B HIS 60 19 2 Y 1 B HIS 61 ? B HIS 61 20 2 Y 1 B HIS 62 ? B HIS 62 21 3 Y 1 A MET 1 ? A MET 1 22 3 Y 1 A HIS 59 ? A HIS 59 23 3 Y 1 A HIS 60 ? A HIS 60 24 3 Y 1 A HIS 61 ? A HIS 61 25 3 Y 1 A HIS 62 ? A HIS 62 26 3 Y 1 B MET 1 ? B MET 1 27 3 Y 1 B HIS 59 ? B HIS 59 28 3 Y 1 B HIS 60 ? B HIS 60 29 3 Y 1 B HIS 61 ? B HIS 61 30 3 Y 1 B HIS 62 ? B HIS 62 31 4 Y 1 A MET 1 ? A MET 1 32 4 Y 1 A HIS 59 ? A HIS 59 33 4 Y 1 A HIS 60 ? A HIS 60 34 4 Y 1 A HIS 61 ? A HIS 61 35 4 Y 1 A HIS 62 ? A HIS 62 36 4 Y 1 B MET 1 ? B MET 1 37 4 Y 1 B HIS 59 ? B HIS 59 38 4 Y 1 B HIS 60 ? B HIS 60 39 4 Y 1 B HIS 61 ? B HIS 61 40 4 Y 1 B HIS 62 ? B HIS 62 41 5 Y 1 A MET 1 ? A MET 1 42 5 Y 1 A HIS 59 ? A HIS 59 43 5 Y 1 A HIS 60 ? A HIS 60 44 5 Y 1 A HIS 61 ? A HIS 61 45 5 Y 1 A HIS 62 ? A HIS 62 46 5 Y 1 B MET 1 ? B MET 1 47 5 Y 1 B HIS 59 ? B HIS 59 48 5 Y 1 B HIS 60 ? B HIS 60 49 5 Y 1 B HIS 61 ? B HIS 61 50 5 Y 1 B HIS 62 ? B HIS 62 51 6 Y 1 A MET 1 ? A MET 1 52 6 Y 1 A HIS 59 ? A HIS 59 53 6 Y 1 A HIS 60 ? A HIS 60 54 6 Y 1 A HIS 61 ? A HIS 61 55 6 Y 1 A HIS 62 ? A HIS 62 56 6 Y 1 B MET 1 ? B MET 1 57 6 Y 1 B HIS 59 ? B HIS 59 58 6 Y 1 B HIS 60 ? B HIS 60 59 6 Y 1 B HIS 61 ? B HIS 61 60 6 Y 1 B HIS 62 ? B HIS 62 61 7 Y 1 A MET 1 ? A MET 1 62 7 Y 1 A HIS 59 ? A HIS 59 63 7 Y 1 A HIS 60 ? A HIS 60 64 7 Y 1 A HIS 61 ? A HIS 61 65 7 Y 1 A HIS 62 ? A HIS 62 66 7 Y 1 B MET 1 ? B MET 1 67 7 Y 1 B HIS 59 ? B HIS 59 68 7 Y 1 B HIS 60 ? B HIS 60 69 7 Y 1 B HIS 61 ? B HIS 61 70 7 Y 1 B HIS 62 ? B HIS 62 71 8 Y 1 A MET 1 ? A MET 1 72 8 Y 1 A HIS 59 ? A HIS 59 73 8 Y 1 A HIS 60 ? A HIS 60 74 8 Y 1 A HIS 61 ? A HIS 61 75 8 Y 1 A HIS 62 ? A HIS 62 76 8 Y 1 B MET 1 ? B MET 1 77 8 Y 1 B HIS 59 ? B HIS 59 78 8 Y 1 B HIS 60 ? B HIS 60 79 8 Y 1 B HIS 61 ? B HIS 61 80 8 Y 1 B HIS 62 ? B HIS 62 81 9 Y 1 A MET 1 ? A MET 1 82 9 Y 1 A HIS 59 ? A HIS 59 83 9 Y 1 A HIS 60 ? A HIS 60 84 9 Y 1 A HIS 61 ? A HIS 61 85 9 Y 1 A HIS 62 ? A HIS 62 86 9 Y 1 B MET 1 ? B MET 1 87 9 Y 1 B HIS 59 ? B HIS 59 88 9 Y 1 B HIS 60 ? B HIS 60 89 9 Y 1 B HIS 61 ? B HIS 61 90 9 Y 1 B HIS 62 ? B HIS 62 91 10 Y 1 A MET 1 ? A MET 1 92 10 Y 1 A HIS 59 ? A HIS 59 93 10 Y 1 A HIS 60 ? A HIS 60 94 10 Y 1 A HIS 61 ? A HIS 61 95 10 Y 1 A HIS 62 ? A HIS 62 96 10 Y 1 B MET 1 ? B MET 1 97 10 Y 1 B HIS 59 ? B HIS 59 98 10 Y 1 B HIS 60 ? B HIS 60 99 10 Y 1 B HIS 61 ? B HIS 61 100 10 Y 1 B HIS 62 ? B HIS 62 101 11 Y 1 A MET 1 ? A MET 1 102 11 Y 1 A HIS 59 ? A HIS 59 103 11 Y 1 A HIS 60 ? A HIS 60 104 11 Y 1 A HIS 61 ? A HIS 61 105 11 Y 1 A HIS 62 ? A HIS 62 106 11 Y 1 B MET 1 ? B MET 1 107 11 Y 1 B HIS 59 ? B HIS 59 108 11 Y 1 B HIS 60 ? B HIS 60 109 11 Y 1 B HIS 61 ? B HIS 61 110 11 Y 1 B HIS 62 ? B HIS 62 111 12 Y 1 A MET 1 ? A MET 1 112 12 Y 1 A HIS 59 ? A HIS 59 113 12 Y 1 A HIS 60 ? A HIS 60 114 12 Y 1 A HIS 61 ? A HIS 61 115 12 Y 1 A HIS 62 ? A HIS 62 116 12 Y 1 B MET 1 ? B MET 1 117 12 Y 1 B HIS 59 ? B HIS 59 118 12 Y 1 B HIS 60 ? B HIS 60 119 12 Y 1 B HIS 61 ? B HIS 61 120 12 Y 1 B HIS 62 ? B HIS 62 121 13 Y 1 A MET 1 ? A MET 1 122 13 Y 1 A HIS 59 ? A HIS 59 123 13 Y 1 A HIS 60 ? A HIS 60 124 13 Y 1 A HIS 61 ? A HIS 61 125 13 Y 1 A HIS 62 ? A HIS 62 126 13 Y 1 B MET 1 ? B MET 1 127 13 Y 1 B HIS 59 ? B HIS 59 128 13 Y 1 B HIS 60 ? B HIS 60 129 13 Y 1 B HIS 61 ? B HIS 61 130 13 Y 1 B HIS 62 ? B HIS 62 131 14 Y 1 A MET 1 ? A MET 1 132 14 Y 1 A HIS 59 ? A HIS 59 133 14 Y 1 A HIS 60 ? A HIS 60 134 14 Y 1 A HIS 61 ? A HIS 61 135 14 Y 1 A HIS 62 ? A HIS 62 136 14 Y 1 B MET 1 ? B MET 1 137 14 Y 1 B HIS 59 ? B HIS 59 138 14 Y 1 B HIS 60 ? B HIS 60 139 14 Y 1 B HIS 61 ? B HIS 61 140 14 Y 1 B HIS 62 ? B HIS 62 141 15 Y 1 A MET 1 ? A MET 1 142 15 Y 1 A HIS 59 ? A HIS 59 143 15 Y 1 A HIS 60 ? A HIS 60 144 15 Y 1 A HIS 61 ? A HIS 61 145 15 Y 1 A HIS 62 ? A HIS 62 146 15 Y 1 B MET 1 ? B MET 1 147 15 Y 1 B HIS 59 ? B HIS 59 148 15 Y 1 B HIS 60 ? B HIS 60 149 15 Y 1 B HIS 61 ? B HIS 61 150 15 Y 1 B HIS 62 ? B HIS 62 151 16 Y 1 A MET 1 ? A MET 1 152 16 Y 1 A HIS 59 ? A HIS 59 153 16 Y 1 A HIS 60 ? A HIS 60 154 16 Y 1 A HIS 61 ? A HIS 61 155 16 Y 1 A HIS 62 ? A HIS 62 156 16 Y 1 B MET 1 ? B MET 1 157 16 Y 1 B HIS 59 ? B HIS 59 158 16 Y 1 B HIS 60 ? B HIS 60 159 16 Y 1 B HIS 61 ? B HIS 61 160 16 Y 1 B HIS 62 ? B HIS 62 161 17 Y 1 A MET 1 ? A MET 1 162 17 Y 1 A HIS 59 ? A HIS 59 163 17 Y 1 A HIS 60 ? A HIS 60 164 17 Y 1 A HIS 61 ? A HIS 61 165 17 Y 1 A HIS 62 ? A HIS 62 166 17 Y 1 B MET 1 ? B MET 1 167 17 Y 1 B HIS 59 ? B HIS 59 168 17 Y 1 B HIS 60 ? B HIS 60 169 17 Y 1 B HIS 61 ? B HIS 61 170 17 Y 1 B HIS 62 ? B HIS 62 171 18 Y 1 A MET 1 ? A MET 1 172 18 Y 1 A HIS 59 ? A HIS 59 173 18 Y 1 A HIS 60 ? A HIS 60 174 18 Y 1 A HIS 61 ? A HIS 61 175 18 Y 1 A HIS 62 ? A HIS 62 176 18 Y 1 B MET 1 ? B MET 1 177 18 Y 1 B HIS 59 ? B HIS 59 178 18 Y 1 B HIS 60 ? B HIS 60 179 18 Y 1 B HIS 61 ? B HIS 61 180 18 Y 1 B HIS 62 ? B HIS 62 181 19 Y 1 A MET 1 ? A MET 1 182 19 Y 1 A HIS 59 ? A HIS 59 183 19 Y 1 A HIS 60 ? A HIS 60 184 19 Y 1 A HIS 61 ? A HIS 61 185 19 Y 1 A HIS 62 ? A HIS 62 186 19 Y 1 B MET 1 ? B MET 1 187 19 Y 1 B HIS 59 ? B HIS 59 188 19 Y 1 B HIS 60 ? B HIS 60 189 19 Y 1 B HIS 61 ? B HIS 61 190 19 Y 1 B HIS 62 ? B HIS 62 191 20 Y 1 A MET 1 ? A MET 1 192 20 Y 1 A HIS 59 ? A HIS 59 193 20 Y 1 A HIS 60 ? A HIS 60 194 20 Y 1 A HIS 61 ? A HIS 61 195 20 Y 1 A HIS 62 ? A HIS 62 196 20 Y 1 B MET 1 ? B MET 1 197 20 Y 1 B HIS 59 ? B HIS 59 198 20 Y 1 B HIS 60 ? B HIS 60 199 20 Y 1 B HIS 61 ? B HIS 61 200 20 Y 1 B HIS 62 ? B HIS 62 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 750 ? 2 DRX Bruker 500 ? 3 INOVA Varian 600 ? # _atom_sites.entry_id 2GJH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_