data_2GJI # _entry.id 2GJI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GJI pdb_00002gji 10.2210/pdb2gji/pdb RCSB RCSB037195 ? ? WWPDB D_1000037195 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GJ2 _pdbx_database_related.details 'Crystal Structure of the same protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GJI _pdbx_database_status.recvd_initial_deposition_date 2006-03-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Y.' 1 'Wu, J.L.' 2 'Song, J.X.' 3 'Sivaraman, J.' 4 'Hew, C.L.' 5 # _citation.id primary _citation.title ;Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites ; _citation.journal_abbrev J.Virol. _citation.journal_volume 80 _citation.page_first 10419 _citation.page_last 10427 _citation.year 2006 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16956937 _citation.pdbx_database_id_DOI 10.1128/JVI.00698-06 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 ? primary 'Wu, J.L.' 2 ? primary 'Song, J.X.' 3 ? primary 'Sivaraman, J.' 4 ? primary 'Hew, C.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description wsv230 _entity.formula_weight 9500.659 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name VP9 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMI VPTTE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMI VPTTE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 THR n 1 7 PHE n 1 8 GLN n 1 9 THR n 1 10 ASP n 1 11 ALA n 1 12 ASP n 1 13 PHE n 1 14 LEU n 1 15 LEU n 1 16 VAL n 1 17 GLY n 1 18 ASP n 1 19 ASP n 1 20 THR n 1 21 SER n 1 22 ARG n 1 23 TYR n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 MET n 1 28 LYS n 1 29 THR n 1 30 PHE n 1 31 ASP n 1 32 THR n 1 33 VAL n 1 34 GLU n 1 35 ALA n 1 36 VAL n 1 37 ARG n 1 38 LYS n 1 39 SER n 1 40 ASP n 1 41 LEU n 1 42 ASP n 1 43 ASP n 1 44 ARG n 1 45 VAL n 1 46 TYR n 1 47 MET n 1 48 VAL n 1 49 CYS n 1 50 LEU n 1 51 LYS n 1 52 GLN n 1 53 GLY n 1 54 SER n 1 55 THR n 1 56 PHE n 1 57 VAL n 1 58 LEU n 1 59 ASN n 1 60 GLY n 1 61 GLY n 1 62 ILE n 1 63 GLU n 1 64 GLU n 1 65 LEU n 1 66 ARG n 1 67 LEU n 1 68 LEU n 1 69 THR n 1 70 GLY n 1 71 ASP n 1 72 SER n 1 73 THR n 1 74 LEU n 1 75 GLU n 1 76 ILE n 1 77 GLN n 1 78 PRO n 1 79 MET n 1 80 ILE n 1 81 VAL n 1 82 PRO n 1 83 THR n 1 84 THR n 1 85 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Whispovirus _entity_src_gen.pdbx_gene_src_gene WSV230 _entity_src_gen.gene_src_species 'White spot syndrome virus 1' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shrimp white spot syndrome virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 92652 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q91LD0_WSSV _struct_ref.pdbx_db_accession Q91LD0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPT TE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GJI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q91LD0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GJI GLY A 1 ? UNP Q91LD0 ? ? 'cloning artifact' -2 1 1 2GJI SER A 2 ? UNP Q91LD0 ? ? 'cloning artifact' -1 2 1 2GJI HIS A 3 ? UNP Q91LD0 ? ? 'cloning artifact' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 HCCH-TOCSY 1 4 1 HNCACB 1 5 1 'CBCA(CO)NH' 1 6 1 HSQC 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.72 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM phosphate buffer, 3mM VP9; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 800 ? 2 DRX Bruker 500 ? # _pdbx_nmr_refine.entry_id 2GJI _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2GJI _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 2GJI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GJI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2004 'Delaglio, F.' 1 'structure solution' CYANA 2.1 'Guntert, P.' 2 'data analysis' NMRView 5.2.2 'Johnson, B.A.' 3 refinement CYANA 2.1 'Guntert, P.' 4 # _exptl.entry_id 2GJI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2GJI _struct.title 'NMR solution structure of VP9 from White Spot Syndrome Virus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GJI _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'WSSV, Ferredoxin fold, Metal binding, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 22 ? THR A 29 ? ARG A 19 THR A 26 1 ? 8 HELX_P HELX_P2 2 GLY A 61 ? GLY A 70 ? GLY A 58 GLY A 67 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 7 ? THR A 9 ? PHE A 4 THR A 6 A 2 PHE A 56 ? LEU A 58 ? PHE A 53 LEU A 55 B 1 VAL A 33 ? LYS A 38 ? VAL A 30 LYS A 35 B 2 VAL A 45 ? LEU A 50 ? VAL A 42 LEU A 47 B 3 PHE A 13 ? VAL A 16 ? PHE A 10 VAL A 13 B 4 GLU A 75 ? PRO A 78 ? GLU A 72 PRO A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 9 ? N THR A 6 O PHE A 56 ? O PHE A 53 B 1 2 N ARG A 37 ? N ARG A 34 O MET A 47 ? O MET A 44 B 2 3 O VAL A 48 ? O VAL A 45 N PHE A 13 ? N PHE A 10 B 3 4 N LEU A 14 ? N LEU A 11 O GLN A 77 ? O GLN A 74 # _database_PDB_matrix.entry_id 2GJI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GJI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 ALA 5 2 2 ALA ALA A . n A 1 6 THR 6 3 3 THR THR A . n A 1 7 PHE 7 4 4 PHE PHE A . n A 1 8 GLN 8 5 5 GLN GLN A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 ASP 10 7 7 ASP ASP A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 ASP 12 9 9 ASP ASP A . n A 1 13 PHE 13 10 10 PHE PHE A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ASP 18 15 15 ASP ASP A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 THR 20 17 17 THR THR A . n A 1 21 SER 21 18 18 SER SER A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 TYR 23 20 20 TYR TYR A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 VAL 26 23 23 VAL VAL A . n A 1 27 MET 27 24 24 MET MET A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 THR 32 29 29 THR THR A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 VAL 36 33 33 VAL VAL A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 LYS 38 35 35 LYS LYS A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 ASP 42 39 39 ASP ASP A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 VAL 45 42 42 VAL VAL A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 MET 47 44 44 MET MET A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 CYS 49 46 46 CYS CYS A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 GLN 52 49 49 GLN GLN A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 SER 54 51 51 SER SER A . n A 1 55 THR 55 52 52 THR THR A . n A 1 56 PHE 56 53 53 PHE PHE A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 ASN 59 56 56 ASN ASN A . n A 1 60 GLY 60 57 57 GLY GLY A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 ILE 62 59 59 ILE ILE A . n A 1 63 GLU 63 60 60 GLU GLU A . n A 1 64 GLU 64 61 61 GLU GLU A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 ARG 66 63 63 ARG ARG A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 THR 69 66 66 THR THR A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 ASP 71 68 68 ASP ASP A . n A 1 72 SER 72 69 69 SER SER A . n A 1 73 THR 73 70 70 THR THR A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 GLN 77 74 74 GLN GLN A . n A 1 78 PRO 78 75 75 PRO PRO A . n A 1 79 MET 79 76 76 MET MET A . n A 1 80 ILE 80 77 77 ILE ILE A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 PRO 82 79 79 PRO PRO A . n A 1 83 THR 83 80 80 THR THR A . n A 1 84 THR 84 81 81 THR THR A . n A 1 85 GLU 85 82 82 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-19 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -102.54 40.36 2 1 GLN A 49 ? ? -54.23 107.61 3 2 ASP A 7 ? ? -93.03 43.71 4 2 LEU A 65 ? ? -53.09 -74.08 5 3 ALA A 2 ? ? -110.14 52.40 6 3 ASP A 7 ? ? -95.15 44.06 7 3 ARG A 41 ? ? -95.67 30.80 8 4 ARG A 41 ? ? -94.99 30.15 9 4 GLN A 49 ? ? -56.84 109.52 10 4 LEU A 65 ? ? -59.64 -74.73 11 4 PRO A 79 ? ? -69.80 -179.77 12 5 ALA A 2 ? ? -119.90 66.79 13 5 ASP A 7 ? ? -95.07 37.63 14 5 ASP A 16 ? ? 51.99 73.85 15 5 GLN A 49 ? ? -59.20 109.59 16 5 LEU A 65 ? ? -53.78 -74.29 17 6 ASP A 7 ? ? -97.73 36.00 18 6 ARG A 41 ? ? -95.74 30.34 19 6 LEU A 65 ? ? -51.68 -73.79 20 7 ASP A 7 ? ? -93.16 43.93 21 7 ARG A 41 ? ? -95.53 30.73 22 8 ALA A 2 ? ? -107.21 62.53 23 8 LEU A 65 ? ? -54.98 -70.07 24 8 PRO A 79 ? ? -69.72 74.48 25 8 THR A 80 ? ? 47.65 83.49 26 8 THR A 81 ? ? -161.32 60.12 27 9 ALA A 2 ? ? -103.17 64.64 28 9 THR A 3 ? ? -173.84 146.11 29 9 ASP A 7 ? ? -94.95 39.78 30 9 ASP A 16 ? ? 54.15 75.12 31 9 ARG A 41 ? ? -95.54 32.18 32 9 THR A 80 ? ? 37.33 43.51 33 10 ASP A 7 ? ? -92.84 43.40 34 10 LEU A 65 ? ? -58.69 -71.05 35 10 PRO A 75 ? ? -69.75 98.46 36 10 THR A 81 ? ? -116.14 77.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 #