data_2GLG # _entry.id 2GLG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GLG pdb_00002glg 10.2210/pdb2glg/pdb RCSB RCSB037265 ? ? WWPDB D_1000037265 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GLH _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GLG _pdbx_database_status.recvd_initial_deposition_date 2006-04-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Andreotti, G.' 1 'Lopez-Mendez, B.' 2 'Amodeo, P.' 3 'Morelli, M.A.' 4 'Nakamuta, H.' 5 'Motta, A.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural determinants of salmon calcitonin bioactivity: the role of the Leu-based amphipathic alpha-helix.' J.Biol.Chem. 281 24193 24203 2006 JBCHA3 US 0021-9258 0071 ? 16766525 10.1074/jbc.M603528200 1 ;Solution Conformation of Salmon Calcitonin in Sodium Dodecyl Sulfate Micelles As Determined by Two-Dimensional NMR and Distance Geometry Calculation ; Biochemistry 30 10444 10450 1991 BICHAW US 0006-2960 0033 ? ? ? 2 'Conformational flexibility in calcitonin: The dynamic properties of human and salmon calcitonin' J.Biomol.NMR 13 161 174 1999 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1008365322148 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andreotti, G.' 1 ? primary 'Mendez, B.L.' 2 ? primary 'Amodeo, P.' 3 ? primary 'Morelli, M.A.' 4 ? primary 'Nakamuta, H.' 5 ? primary 'Motta, A.' 6 ? 1 'Motta, A.' 7 ? 1 'Pastore, A.' 8 ? 1 'Goud, N.A.' 9 ? 1 'Morelli, M.A.C.' 10 ? 2 'Amodeo, P.' 11 ? 2 'Motta, A.' 12 ? 2 'Strazullo, G.' 13 ? 2 'Morelli, M.A.C.' 14 ? # _cell.entry_id 2GLG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2GLG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Calcitonin-1 _entity.formula_weight 3366.821 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'P23L, R24A' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'CSNLSTCVLGKLSQELHKLQTYLATNTGSGTP(NH2)' _entity_poly.pdbx_seq_one_letter_code_can CSNLSTCVLGKLSQELHKLQTYLATNTGSGTPX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 SER n 1 3 ASN n 1 4 LEU n 1 5 SER n 1 6 THR n 1 7 CYS n 1 8 VAL n 1 9 LEU n 1 10 GLY n 1 11 LYS n 1 12 LEU n 1 13 SER n 1 14 GLN n 1 15 GLU n 1 16 LEU n 1 17 HIS n 1 18 LYS n 1 19 LEU n 1 20 GLN n 1 21 THR n 1 22 TYR n 1 23 LEU n 1 24 ALA n 1 25 THR n 1 26 ASN n 1 27 THR n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 THR n 1 32 PRO n 1 33 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'synthesis on polyoxyethylenepolystyrene graft resin' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALC1_ONCKE _struct_ref.pdbx_db_accession P01263 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP _struct_ref.pdbx_align_begin 83 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GLG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01263 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GLG LEU A 23 ? UNP P01263 PRO 105 'engineered mutation' 23 1 1 2GLG ALA A 24 ? UNP P01263 ARG 106 'engineered mutation' 24 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 2 '2D NOESY' 1 4 2 '2D TOCSY' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 AMBIENT ? ? . K 2 324 AMBIENT ? ? . K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM [L23,A24]-sCT; 120mM SDS; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2GLG _pdbx_nmr_refine.method 'restrained simulated annealing/energy minimization followed by unrestrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2GLG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 100 _pdbx_nmr_ensemble.conformer_selection_criteria 'periodically sampled unrestrained molecular dynamics structures' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GLG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing XwinNMR ? ? 1 'data analysis' AURELIA ? ? 2 'structure solution' Amber 6.0 ? 3 refinement Amber 6.0 ? 4 # _exptl.entry_id 2GLG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2GLG _struct.title 'NMR structure of the [L23,A24]-sCT mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GLG _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'a-helix, HORMONE-GROWTH FACTOR COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 7 SG ? ? A CYS 1 A CYS 7 1_555 ? ? ? ? ? ? ? 2.051 ? ? covale1 covale both ? A PRO 32 C ? ? ? 1_555 A NH2 33 N ? ? A PRO 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.341 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 33 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 33' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 29 ? SER A 29 . ? 1_555 ? 2 AC1 3 THR A 31 ? THR A 31 . ? 1_555 ? 3 AC1 3 PRO A 32 ? PRO A 32 . ? 1_555 ? # _database_PDB_matrix.entry_id 2GLG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GLG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 NH2 33 33 33 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-20 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 32 CB A TYR 22 ? ? CG A TYR 22 ? ? CD2 A TYR 22 ? ? 117.35 121.00 -3.65 0.60 N 2 64 CB A TYR 22 ? ? CG A TYR 22 ? ? CD2 A TYR 22 ? ? 117.34 121.00 -3.66 0.60 N 3 93 CB A TYR 22 ? ? CG A TYR 22 ? ? CD2 A TYR 22 ? ? 117.35 121.00 -3.65 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 29 ? ? -148.52 -36.58 2 2 SER A 29 ? ? -144.77 -34.00 3 3 SER A 29 ? ? -161.18 -43.34 4 4 SER A 29 ? ? -145.34 -27.21 5 5 SER A 29 ? ? -145.06 -40.63 6 6 SER A 29 ? ? -132.44 -37.30 7 7 SER A 29 ? ? -131.54 -30.23 8 8 SER A 29 ? ? -160.20 -41.09 9 9 SER A 29 ? ? -145.84 -36.99 10 10 SER A 29 ? ? -146.40 -33.51 11 11 SER A 29 ? ? -145.84 -42.08 12 12 SER A 29 ? ? -149.56 -42.26 13 13 SER A 29 ? ? -150.31 -41.52 14 14 SER A 29 ? ? -140.22 -19.87 15 15 SER A 29 ? ? -143.20 -36.53 16 16 SER A 29 ? ? -153.76 -52.33 17 17 SER A 29 ? ? -145.92 -50.17 18 18 SER A 29 ? ? -158.96 -48.06 19 19 SER A 29 ? ? -157.00 -28.03 20 20 SER A 29 ? ? -146.91 -47.39 21 21 SER A 29 ? ? -146.48 -49.06 22 22 SER A 29 ? ? -142.16 -48.48 23 23 SER A 29 ? ? -135.72 -51.81 24 24 SER A 29 ? ? -131.62 -46.47 25 26 SER A 29 ? ? -131.25 -39.59 26 27 SER A 29 ? ? -154.23 -36.57 27 28 SER A 29 ? ? -141.86 -49.12 28 30 SER A 29 ? ? -157.10 -50.14 29 31 SER A 29 ? ? -134.05 -48.22 30 32 SER A 29 ? ? -151.67 -51.95 31 33 SER A 29 ? ? -148.93 -37.45 32 34 SER A 29 ? ? -140.61 -50.72 33 35 SER A 29 ? ? -151.12 -46.09 34 36 SER A 29 ? ? -135.41 -45.25 35 37 THR A 27 ? ? -66.43 34.14 36 39 SER A 29 ? ? -131.60 -33.21 37 40 SER A 29 ? ? -148.40 -47.49 38 44 SER A 29 ? ? -146.99 -51.09 39 45 SER A 29 ? ? -137.05 -47.44 40 46 SER A 29 ? ? -152.67 -42.84 41 49 SER A 29 ? ? -134.18 -40.51 42 50 SER A 29 ? ? -146.40 -36.74 43 51 THR A 31 ? ? -134.85 -40.07 44 53 SER A 29 ? ? -153.69 -37.71 45 55 SER A 29 ? ? -152.11 -37.73 46 56 SER A 29 ? ? -139.48 -48.87 47 57 SER A 29 ? ? -146.31 -26.39 48 59 THR A 31 ? ? -130.85 -48.26 49 61 SER A 29 ? ? -136.38 -43.69 50 64 SER A 29 ? ? -143.65 -52.73 51 65 SER A 29 ? ? -127.81 -52.69 52 66 SER A 29 ? ? -139.46 -50.30 53 70 SER A 29 ? ? -152.25 24.02 54 72 SER A 29 ? ? -160.65 100.38 55 72 THR A 31 ? ? -100.30 -63.14 56 73 THR A 31 ? ? -111.19 -82.68 57 74 SER A 29 ? ? -162.94 98.37 58 75 SER A 29 ? ? -158.90 89.83 59 75 THR A 31 ? ? -95.40 -64.37 60 77 THR A 31 ? ? -108.25 -63.13 61 79 THR A 27 ? ? -63.71 3.33 62 80 SER A 2 ? ? -67.64 -86.93 63 80 SER A 29 ? ? -113.46 76.07 64 81 SER A 2 ? ? -72.36 -84.67 65 82 SER A 29 ? ? -111.21 73.83 66 83 SER A 2 ? ? -89.98 -73.38 67 84 SER A 2 ? ? -93.07 -71.31 68 85 SER A 2 ? ? -54.28 -74.07 69 85 SER A 29 ? ? -140.69 -20.96 70 86 LEU A 4 ? ? -77.98 -78.68 71 86 SER A 5 ? ? -23.88 -69.41 72 86 SER A 29 ? ? -130.25 -51.52 73 87 SER A 29 ? ? -136.02 -47.50 74 88 SER A 2 ? ? -35.53 -73.46 75 88 SER A 29 ? ? -135.45 -38.88 76 91 SER A 29 ? ? -133.98 -49.01 77 92 SER A 29 ? ? -136.77 -47.87 78 93 SER A 29 ? ? -156.84 -42.93 79 94 SER A 29 ? ? -152.96 -36.34 80 95 SER A 29 ? ? -144.27 -49.76 81 96 SER A 2 ? ? -39.33 -73.38 82 96 SER A 29 ? ? -147.84 -39.87 83 97 SER A 29 ? ? -139.34 -53.72 84 98 SER A 29 ? ? -144.16 -40.97 85 99 SER A 5 ? ? -41.48 -70.53 86 99 SER A 29 ? ? -135.72 -39.01 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 3 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 22 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.066 _pdbx_validate_planes.type 'SIDE CHAIN' #