data_2GQE # _entry.id 2GQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GQE pdb_00002gqe 10.2210/pdb2gqe/pdb RCSB RCSB037426 ? ? WWPDB D_1000037426 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-10 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_ref_seq_dif.details' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GQE _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1NJ3 'Structure and Ubiquitin Interactions of the Conserved NZF Domain of Npl4' unspecified PDB 1Q5W 'Ubiquitin Recognition by Npl4 Zinc-Fingers' unspecified BMRB 5669 'Structure and Ubiquitin Interactions of the Conserved NZF Domain of Npl4' unspecified BMRB 7158 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Higa, M.M.' 1 'Alam, S.L.' 2 'Sundquist, W.I.' 3 'Ullman, K.S.' 4 # _citation.id primary _citation.title 'Molecular Characterization of the Ran-binding Zinc Finger Domain of Nup153.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 17090 _citation.page_last 17100 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17426026 _citation.pdbx_database_id_DOI 10.1074/jbc.M702715200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Higa, M.M.' 1 ? primary 'Alam, S.L.' 2 ? primary 'Sundquist, W.I.' 3 ? primary 'Ullman, K.S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear pore complex protein Nup153' 3492.093 1 ? ? 'second zinc finger, residues 722-750' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nucleoporin Nup153, 153 kDa nucleoporin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMVIGTWDCDTCLVQNKPEAIKCVACETPKP _entity_poly.pdbx_seq_one_letter_code_can GHMVIGTWDCDTCLVQNKPEAIKCVACETPKP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 VAL n 1 5 ILE n 1 6 GLY n 1 7 THR n 1 8 TRP n 1 9 ASP n 1 10 CYS n 1 11 ASP n 1 12 THR n 1 13 CYS n 1 14 LEU n 1 15 VAL n 1 16 GLN n 1 17 ASN n 1 18 LYS n 1 19 PRO n 1 20 GLU n 1 21 ALA n 1 22 ILE n 1 23 LYS n 1 24 CYS n 1 25 VAL n 1 26 ALA n 1 27 CYS n 1 28 GLU n 1 29 THR n 1 30 PRO n 1 31 LYS n 1 32 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NUP153 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) Codon plus' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pGex2T variant with TEV cleavage site' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 HIS 2 1 1 HIS HIS A . n A 1 3 MET 3 2 2 MET MET A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 ILE 5 4 4 ILE ILE A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 THR 7 6 6 THR THR A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 CYS 10 9 9 CYS CYS A . n A 1 11 ASP 11 10 10 ASP ASP A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 CYS 13 12 12 CYS CYS A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 GLN 16 15 15 GLN GLN A . n A 1 17 ASN 17 16 16 ASN ASN A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 PRO 19 18 18 PRO PRO A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 CYS 24 23 23 CYS CYS A . n A 1 25 VAL 25 24 24 VAL VAL A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 CYS 27 26 26 CYS CYS A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 THR 29 28 28 THR THR A . n A 1 30 PRO 30 29 29 PRO PRO A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 PRO 32 31 31 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 32 _pdbx_nonpoly_scheme.auth_seq_num 32 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2GQE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2GQE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2GQE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2GQE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2GQE _struct.title 'Molecular characterization of the Ran binding zinc finger domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GQE _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'Zinc finger, Ran, Nuclear Pore, zinc knuckle, nucleoporin, pore, transport, NUP153, NUP358, RanBP2, TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NU153_HUMAN _struct_ref.pdbx_db_accession P49790 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VIGTWDCDTCLVQNKPEAIKCVACETPKP _struct_ref.pdbx_align_begin 722 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GQE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49790 _struct_ref_seq.db_align_beg 722 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 750 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GQE GLY A 1 ? UNP P49790 ? ? 'cloning artifact' 0 1 1 2GQE HIS A 2 ? UNP P49790 ? ? 'cloning artifact' 1 2 1 2GQE MET A 3 ? UNP P49790 ? ? 'cloning artifact' 2 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 32 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 32 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc3 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 32 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc4 metalc ? ? A CYS 27 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 32 1_555 ? ? ? ? ? ? ? 2.401 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 13 ? A CYS 12 ? 1_555 109.4 ? 2 SG ? A CYS 10 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 24 ? A CYS 23 ? 1_555 109.5 ? 3 SG ? A CYS 13 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 24 ? A CYS 23 ? 1_555 109.5 ? 4 SG ? A CYS 10 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 27 ? A CYS 26 ? 1_555 109.4 ? 5 SG ? A CYS 13 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 27 ? A CYS 26 ? 1_555 109.5 ? 6 SG ? A CYS 24 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG ? A CYS 27 ? A CYS 26 ? 1_555 109.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 8 ? ASP A 9 ? TRP A 7 ASP A 8 A 2 GLN A 16 ? ASN A 17 ? GLN A 15 ASN A 16 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TRP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 7 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 17 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 32 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 32' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 10 ? CYS A 9 . ? 1_555 ? 2 AC1 4 CYS A 13 ? CYS A 12 . ? 1_555 ? 3 AC1 4 CYS A 24 ? CYS A 23 . ? 1_555 ? 4 AC1 4 CYS A 27 ? CYS A 26 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 4 ? ? -51.60 -179.14 2 1 THR A 11 ? ? -130.41 -36.73 3 1 LEU A 13 ? ? 61.95 75.55 4 1 ALA A 25 ? ? -135.84 -43.77 5 2 CYS A 9 ? ? -58.74 175.80 6 2 THR A 11 ? ? -127.29 -54.65 7 2 LEU A 13 ? ? 72.31 71.67 8 2 ALA A 25 ? ? -134.47 -45.63 9 2 GLU A 27 ? ? 70.55 47.97 10 3 HIS A 1 ? ? -175.34 -175.82 11 3 THR A 11 ? ? -130.73 -36.40 12 3 LEU A 13 ? ? 61.56 76.09 13 3 ALA A 25 ? ? -135.46 -41.20 14 4 HIS A 1 ? ? -107.75 49.41 15 4 THR A 6 ? ? -179.60 148.41 16 4 THR A 11 ? ? -120.56 -53.13 17 4 LEU A 13 ? ? 62.04 82.54 18 4 ALA A 25 ? ? -133.51 -45.55 19 5 ILE A 4 ? ? -90.10 52.19 20 5 THR A 6 ? ? -38.96 138.71 21 5 LEU A 13 ? ? 57.07 90.92 22 5 VAL A 14 ? ? -171.62 136.02 23 5 ALA A 25 ? ? -131.23 -46.89 24 6 THR A 6 ? ? -36.33 141.07 25 6 CYS A 9 ? ? -59.67 172.91 26 6 THR A 11 ? ? -131.74 -36.85 27 6 LEU A 13 ? ? 60.90 76.95 28 6 ALA A 25 ? ? -136.64 -46.48 29 6 GLU A 27 ? ? 70.08 36.84 30 7 LEU A 13 ? ? 62.91 90.48 31 7 ALA A 25 ? ? -132.02 -46.69 32 8 LEU A 13 ? ? 57.81 85.56 33 8 ALA A 25 ? ? -132.51 -44.73 34 9 LEU A 13 ? ? 54.70 92.52 35 9 ALA A 25 ? ? -130.93 -43.62 36 9 GLU A 27 ? ? 70.59 46.67 37 10 THR A 11 ? ? -126.42 -55.78 38 10 LEU A 13 ? ? 70.34 74.42 39 10 ALA A 25 ? ? -140.90 -45.53 40 10 GLU A 27 ? ? 71.82 43.33 41 11 LEU A 13 ? ? 62.09 80.89 42 11 ALA A 25 ? ? -136.50 -45.62 43 12 MET A 2 ? ? -59.73 171.42 44 12 ILE A 4 ? ? -94.44 53.90 45 12 THR A 6 ? ? -36.59 133.98 46 12 THR A 11 ? ? -124.58 -59.67 47 12 LEU A 13 ? ? 71.62 74.96 48 12 ALA A 25 ? ? -140.64 -45.36 49 12 GLU A 27 ? ? 71.19 46.00 50 13 THR A 6 ? ? -179.19 148.46 51 13 LEU A 13 ? ? 62.59 82.94 52 13 ALA A 25 ? ? -133.91 -45.60 53 13 GLU A 27 ? ? 70.50 38.04 54 14 VAL A 3 ? ? -37.47 100.13 55 14 THR A 6 ? ? 179.04 146.35 56 14 LEU A 13 ? ? 68.53 79.48 57 14 ALA A 25 ? ? -133.11 -46.04 58 15 THR A 11 ? ? -128.14 -59.45 59 15 LEU A 13 ? ? 69.32 75.23 60 15 ALA A 25 ? ? -140.73 -45.44 61 15 GLU A 27 ? ? 71.77 45.21 62 16 HIS A 1 ? ? -173.51 110.02 63 16 LEU A 13 ? ? 59.24 73.11 64 16 ALA A 25 ? ? -130.34 -47.37 65 16 GLU A 27 ? ? 70.26 47.05 66 17 MET A 2 ? ? -171.23 117.52 67 17 THR A 6 ? ? -38.40 129.17 68 17 LEU A 13 ? ? 57.42 94.89 69 17 VAL A 14 ? ? -173.61 135.74 70 17 ALA A 25 ? ? -136.24 -42.45 71 17 GLU A 27 ? ? 73.74 40.62 72 18 THR A 6 ? ? -39.62 134.69 73 18 LEU A 13 ? ? 62.42 78.99 74 18 ALA A 25 ? ? -136.38 -46.26 75 18 GLU A 27 ? ? 72.67 36.55 76 19 ILE A 4 ? ? -106.67 71.16 77 19 THR A 6 ? ? -179.60 147.97 78 19 THR A 11 ? ? -120.09 -51.75 79 19 LEU A 13 ? ? 60.25 81.27 80 19 ALA A 25 ? ? -136.58 -39.69 81 19 GLU A 27 ? ? 71.06 36.79 82 20 THR A 6 ? ? -39.90 147.19 83 20 LEU A 13 ? ? 41.41 89.90 84 20 GLU A 27 ? ? 74.36 45.60 # _pdbx_nmr_ensemble.entry_id 2GQE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest target function, least violations, favorable non-bonded energies' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GQE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3 mM hZnF2 U-15N, 13C, 20mM D-Tris, pH 7.0, 50mM NaCl, 1mM D-BME, 10 micromolr ZnCl2, 90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '70mM, 20mM Tris, 50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 HNHA 1 4 1 HNCO 1 5 1 'HN(CO)CA' 1 6 1 HNCACB 1 7 1 'CBCA(CO)NH' 1 8 1 HNHB 1 9 1 'HN(CO)HB' 1 10 1 LRCC 1 11 1 HSQC 1 12 1 HSQC-TROSY 1 13 1 HCCH-TOCSY 1 14 1 '(H)C(CO)NH-TOCSY' 1 15 1 'H(CCO)NH-TOCSY' 1 # _pdbx_nmr_details.entry_id 2GQE _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 2GQE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'Using CYANA automated NOESY assignments' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.1 'GUNTERT, P. ET AL.' 1 'structure solution' CYANA 2.1 'GUNTERT, P. ET AL.' 2 processing Felix ? ? 3 'data analysis' Sparky 3.11.2 'Goddard, T.D. et al.' 4 collection VNMR 2.3C ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 ZN ZN ZN N N 300 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PRO N CA sing N N 209 PRO N CD sing N N 210 PRO N H sing N N 211 PRO CA C sing N N 212 PRO CA CB sing N N 213 PRO CA HA sing N N 214 PRO C O doub N N 215 PRO C OXT sing N N 216 PRO CB CG sing N N 217 PRO CB HB2 sing N N 218 PRO CB HB3 sing N N 219 PRO CG CD sing N N 220 PRO CG HG2 sing N N 221 PRO CG HG3 sing N N 222 PRO CD HD2 sing N N 223 PRO CD HD3 sing N N 224 PRO OXT HXT sing N N 225 THR N CA sing N N 226 THR N H sing N N 227 THR N H2 sing N N 228 THR CA C sing N N 229 THR CA CB sing N N 230 THR CA HA sing N N 231 THR C O doub N N 232 THR C OXT sing N N 233 THR CB OG1 sing N N 234 THR CB CG2 sing N N 235 THR CB HB sing N N 236 THR OG1 HG1 sing N N 237 THR CG2 HG21 sing N N 238 THR CG2 HG22 sing N N 239 THR CG2 HG23 sing N N 240 THR OXT HXT sing N N 241 TRP N CA sing N N 242 TRP N H sing N N 243 TRP N H2 sing N N 244 TRP CA C sing N N 245 TRP CA CB sing N N 246 TRP CA HA sing N N 247 TRP C O doub N N 248 TRP C OXT sing N N 249 TRP CB CG sing N N 250 TRP CB HB2 sing N N 251 TRP CB HB3 sing N N 252 TRP CG CD1 doub Y N 253 TRP CG CD2 sing Y N 254 TRP CD1 NE1 sing Y N 255 TRP CD1 HD1 sing N N 256 TRP CD2 CE2 doub Y N 257 TRP CD2 CE3 sing Y N 258 TRP NE1 CE2 sing Y N 259 TRP NE1 HE1 sing N N 260 TRP CE2 CZ2 sing Y N 261 TRP CE3 CZ3 doub Y N 262 TRP CE3 HE3 sing N N 263 TRP CZ2 CH2 doub Y N 264 TRP CZ2 HZ2 sing N N 265 TRP CZ3 CH2 sing Y N 266 TRP CZ3 HZ3 sing N N 267 TRP CH2 HH2 sing N N 268 TRP OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 INOVA Varian 500 ? # _atom_sites.entry_id 2GQE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_