data_2H3I # _entry.id 2H3I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2H3I pdb_00002h3i 10.2210/pdb2h3i/pdb RCSB RCSB037883 ? ? WWPDB D_1000037883 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2h3f . unspecified PDB 2h3q . unspecified PDB 2h3v . unspecified PDB 2h3z . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2H3I _pdbx_database_status.recvd_initial_deposition_date 2006-05-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saad, J.S.' 1 'Miller, J.' 2 'Tai, J.' 3 'Kim, A.' 4 'Ghanam, R.H.' 5 'Summers, M.F.' 6 # _citation.id primary _citation.title 'Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 11364 _citation.page_last 11369 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16840558 _citation.pdbx_database_id_DOI 10.1073/pnas.0602818103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saad, J.S.' 1 ? primary 'Miller, J.' 2 ? primary 'Tai, J.' 3 ? primary 'Kim, A.' 4 ? primary 'Ghanam, R.H.' 5 ? primary 'Summers, M.F.' 6 ? # _cell.entry_id 2H3I _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2H3I _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gag polyprotein' 14734.616 1 ? ? 'residues 2-132' ? 2 non-polymer syn 'MYRISTIC ACID' 228.371 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY ; _entity_poly.pdbx_seq_one_letter_code_can ;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ARG n 1 4 ALA n 1 5 SER n 1 6 VAL n 1 7 LEU n 1 8 SER n 1 9 GLY n 1 10 GLY n 1 11 GLU n 1 12 LEU n 1 13 ASP n 1 14 LYS n 1 15 TRP n 1 16 GLU n 1 17 LYS n 1 18 ILE n 1 19 ARG n 1 20 LEU n 1 21 ARG n 1 22 PRO n 1 23 GLY n 1 24 GLY n 1 25 LYS n 1 26 LYS n 1 27 GLN n 1 28 TYR n 1 29 LYS n 1 30 LEU n 1 31 LYS n 1 32 HIS n 1 33 ILE n 1 34 VAL n 1 35 TRP n 1 36 ALA n 1 37 SER n 1 38 ARG n 1 39 GLU n 1 40 LEU n 1 41 GLU n 1 42 ARG n 1 43 PHE n 1 44 ALA n 1 45 VAL n 1 46 ASN n 1 47 PRO n 1 48 GLY n 1 49 LEU n 1 50 LEU n 1 51 GLU n 1 52 THR n 1 53 SER n 1 54 GLU n 1 55 GLY n 1 56 CYS n 1 57 ARG n 1 58 GLN n 1 59 ILE n 1 60 LEU n 1 61 GLY n 1 62 GLN n 1 63 LEU n 1 64 GLN n 1 65 PRO n 1 66 SER n 1 67 LEU n 1 68 GLN n 1 69 THR n 1 70 GLY n 1 71 SER n 1 72 GLU n 1 73 GLU n 1 74 LEU n 1 75 ARG n 1 76 SER n 1 77 LEU n 1 78 TYR n 1 79 ASN n 1 80 THR n 1 81 ILE n 1 82 ALA n 1 83 VAL n 1 84 LEU n 1 85 TYR n 1 86 CYS n 1 87 VAL n 1 88 HIS n 1 89 GLN n 1 90 ARG n 1 91 ILE n 1 92 ASP n 1 93 VAL n 1 94 LYS n 1 95 ASP n 1 96 THR n 1 97 LYS n 1 98 GLU n 1 99 ALA n 1 100 LEU n 1 101 ASP n 1 102 LYS n 1 103 ILE n 1 104 GLU n 1 105 GLU n 1 106 GLU n 1 107 GLN n 1 108 ASN n 1 109 LYS n 1 110 SER n 1 111 LYS n 1 112 LYS n 1 113 LYS n 1 114 ALA n 1 115 GLN n 1 116 GLN n 1 117 ALA n 1 118 ALA n 1 119 ALA n 1 120 ASP n 1 121 THR n 1 122 GLY n 1 123 ASN n 1 124 ASN n 1 125 SER n 1 126 GLN n 1 127 VAL n 1 128 SER n 1 129 GLN n 1 130 ASN n 1 131 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2H3I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MYR non-polymer . 'MYRISTIC ACID' ? 'C14 H28 O2' 228.371 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM phosphate buffer, 5mM DTT, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 800 ? 2 DMX Bruker 600 ? # _pdbx_nmr_ensemble.entry_id 2H3I _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2H3I _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'P.GUNTERT ET AL.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2H3I _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2H3I _struct.title 'Solution structure of the HIV-1 myristoylated Matrix protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2H3I _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'HIV-1 myristoylated matrix protein, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 8 ? GLU A 16 ? SER A 9 GLU A 17 1 ? 9 HELX_P HELX_P2 2 LYS A 29 ? GLU A 41 ? LYS A 30 GLU A 42 1 ? 13 HELX_P HELX_P3 3 THR A 52 ? GLN A 64 ? THR A 53 GLN A 65 1 ? 13 HELX_P HELX_P4 4 PRO A 65 ? LEU A 67 ? PRO A 66 LEU A 68 5 ? 3 HELX_P HELX_P5 5 SER A 71 ? GLN A 89 ? SER A 72 GLN A 90 1 ? 19 HELX_P HELX_P6 6 ASP A 95 ? GLN A 115 ? ASP A 96 GLN A 116 1 ? 21 HELX_P HELX_P7 7 GLN A 116 ? GLY A 122 ? GLN A 117 GLY A 123 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id MYR _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id C1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 1 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id MYR _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.329 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MYR _struct_site.pdbx_auth_seq_id 1 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'BINDING SITE FOR RESIDUE MYR A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLY A 1 ? GLY A 2 . ? 1_555 ? 2 AC1 9 SER A 5 ? SER A 6 . ? 1_555 ? 3 AC1 9 VAL A 6 ? VAL A 7 . ? 1_555 ? 4 AC1 9 LEU A 7 ? LEU A 8 . ? 1_555 ? 5 AC1 9 ILE A 33 ? ILE A 34 . ? 1_555 ? 6 AC1 9 SER A 37 ? SER A 38 . ? 1_555 ? 7 AC1 9 PRO A 47 ? PRO A 48 . ? 1_555 ? 8 AC1 9 LEU A 50 ? LEU A 51 . ? 1_555 ? 9 AC1 9 LEU A 84 ? LEU A 85 . ? 1_555 ? # _database_PDB_matrix.entry_id 2H3I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2H3I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 2 GLY GLY A . n A 1 2 ALA 2 3 3 ALA ALA A . n A 1 3 ARG 3 4 4 ARG ARG A . n A 1 4 ALA 4 5 5 ALA ALA A . n A 1 5 SER 5 6 6 SER SER A . n A 1 6 VAL 6 7 7 VAL VAL A . n A 1 7 LEU 7 8 8 LEU LEU A . n A 1 8 SER 8 9 9 SER SER A . n A 1 9 GLY 9 10 10 GLY GLY A . n A 1 10 GLY 10 11 11 GLY GLY A . n A 1 11 GLU 11 12 12 GLU GLU A . n A 1 12 LEU 12 13 13 LEU LEU A . n A 1 13 ASP 13 14 14 ASP ASP A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 TRP 15 16 16 TRP TRP A . n A 1 16 GLU 16 17 17 GLU GLU A . n A 1 17 LYS 17 18 18 LYS LYS A . n A 1 18 ILE 18 19 19 ILE ILE A . n A 1 19 ARG 19 20 20 ARG ARG A . n A 1 20 LEU 20 21 21 LEU LEU A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 PRO 22 23 23 PRO PRO A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 GLY 24 25 25 GLY GLY A . n A 1 25 LYS 25 26 26 LYS LYS A . n A 1 26 LYS 26 27 27 LYS LYS A . n A 1 27 GLN 27 28 28 GLN GLN A . n A 1 28 TYR 28 29 29 TYR TYR A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 LYS 31 32 32 LYS LYS A . n A 1 32 HIS 32 33 33 HIS HIS A . n A 1 33 ILE 33 34 34 ILE ILE A . n A 1 34 VAL 34 35 35 VAL VAL A . n A 1 35 TRP 35 36 36 TRP TRP A . n A 1 36 ALA 36 37 37 ALA ALA A . n A 1 37 SER 37 38 38 SER SER A . n A 1 38 ARG 38 39 39 ARG ARG A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 GLU 41 42 42 GLU GLU A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 PHE 43 44 44 PHE PHE A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 ASN 46 47 47 ASN ASN A . n A 1 47 PRO 47 48 48 PRO PRO A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 LEU 49 50 50 LEU LEU A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 THR 52 53 53 THR THR A . n A 1 53 SER 53 54 54 SER SER A . n A 1 54 GLU 54 55 55 GLU GLU A . n A 1 55 GLY 55 56 56 GLY GLY A . n A 1 56 CYS 56 57 57 CYS CYS A . n A 1 57 ARG 57 58 58 ARG ARG A . n A 1 58 GLN 58 59 59 GLN GLN A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 LEU 60 61 61 LEU LEU A . n A 1 61 GLY 61 62 62 GLY GLY A . n A 1 62 GLN 62 63 63 GLN GLN A . n A 1 63 LEU 63 64 64 LEU LEU A . n A 1 64 GLN 64 65 65 GLN GLN A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 SER 66 67 67 SER SER A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 THR 69 70 70 THR THR A . n A 1 70 GLY 70 71 71 GLY GLY A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 GLU 72 73 73 GLU GLU A . n A 1 73 GLU 73 74 74 GLU GLU A . n A 1 74 LEU 74 75 75 LEU LEU A . n A 1 75 ARG 75 76 76 ARG ARG A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 LEU 77 78 78 LEU LEU A . n A 1 78 TYR 78 79 79 TYR TYR A . n A 1 79 ASN 79 80 80 ASN ASN A . n A 1 80 THR 80 81 81 THR THR A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 ALA 82 83 83 ALA ALA A . n A 1 83 VAL 83 84 84 VAL VAL A . n A 1 84 LEU 84 85 85 LEU LEU A . n A 1 85 TYR 85 86 86 TYR TYR A . n A 1 86 CYS 86 87 87 CYS CYS A . n A 1 87 VAL 87 88 88 VAL VAL A . n A 1 88 HIS 88 89 89 HIS HIS A . n A 1 89 GLN 89 90 90 GLN GLN A . n A 1 90 ARG 90 91 91 ARG ARG A . n A 1 91 ILE 91 92 92 ILE ILE A . n A 1 92 ASP 92 93 93 ASP ASP A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 LYS 94 95 95 LYS LYS A . n A 1 95 ASP 95 96 96 ASP ASP A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 LYS 97 98 98 LYS LYS A . n A 1 98 GLU 98 99 99 GLU GLU A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 LEU 100 101 101 LEU LEU A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 LYS 102 103 103 LYS LYS A . n A 1 103 ILE 103 104 104 ILE ILE A . n A 1 104 GLU 104 105 105 GLU GLU A . n A 1 105 GLU 105 106 106 GLU GLU A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 GLN 107 108 108 GLN GLN A . n A 1 108 ASN 108 109 109 ASN ASN A . n A 1 109 LYS 109 110 110 LYS LYS A . n A 1 110 SER 110 111 111 SER SER A . n A 1 111 LYS 111 112 112 LYS LYS A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 LYS 113 114 114 LYS LYS A . n A 1 114 ALA 114 115 115 ALA ALA A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 GLN 116 117 117 GLN GLN A . n A 1 117 ALA 117 118 118 ALA ALA A . n A 1 118 ALA 118 119 119 ALA ALA A . n A 1 119 ALA 119 120 120 ALA ALA A . n A 1 120 ASP 120 121 121 ASP ASP A . n A 1 121 THR 121 122 122 THR THR A . n A 1 122 GLY 122 123 123 GLY GLY A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 ASN 124 125 125 ASN ASN A . n A 1 125 SER 125 126 126 SER SER A . n A 1 126 GLN 126 127 127 GLN GLN A . n A 1 127 VAL 127 128 128 VAL VAL A . n A 1 128 SER 128 129 129 SER SER A . n A 1 129 GLN 129 130 130 GLN GLN A . n A 1 130 ASN 130 131 131 ASN ASN A . n A 1 131 TYR 131 132 132 TYR TYR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id MYR _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id MYR _pdbx_nonpoly_scheme.auth_mon_id MYR _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 66.74 129.95 2 1 VAL A 7 ? ? -96.70 -78.44 3 1 LEU A 8 ? ? -14.55 114.34 4 1 ASP A 96 ? ? 178.57 178.68 5 1 VAL A 128 ? ? -170.99 136.40 6 2 ALA A 5 ? ? -60.44 -173.04 7 2 SER A 6 ? ? 63.37 82.29 8 2 GLU A 52 ? ? -100.26 44.23 9 2 THR A 53 ? ? -178.17 119.75 10 2 PRO A 66 ? ? -69.73 2.08 11 2 THR A 70 ? ? -142.58 46.22 12 2 ASP A 96 ? ? 175.73 -179.01 13 2 LYS A 98 ? ? -93.43 -66.76 14 2 LYS A 114 ? ? -148.23 27.24 15 2 ALA A 119 ? ? -158.54 27.71 16 3 SER A 6 ? ? 63.39 79.61 17 3 LYS A 114 ? ? -94.82 -63.58 18 3 ASP A 121 ? ? -106.89 57.72 19 3 ASN A 125 ? ? -144.49 29.22 20 3 GLN A 127 ? ? -165.13 73.41 21 4 ALA A 3 ? ? -165.92 38.98 22 4 ARG A 4 ? ? 62.70 67.20 23 4 VAL A 7 ? ? -94.21 -77.17 24 4 LEU A 8 ? ? -16.25 117.42 25 4 GLN A 117 ? ? -134.31 -63.27 26 4 ALA A 120 ? ? -149.97 -54.53 27 4 GLN A 127 ? ? -146.43 -59.28 28 4 VAL A 128 ? ? -69.31 89.43 29 4 GLN A 130 ? ? -163.31 27.85 30 5 SER A 6 ? ? 179.40 116.12 31 5 VAL A 7 ? ? -96.76 -78.09 32 5 LEU A 8 ? ? -14.51 113.50 33 5 THR A 70 ? ? -89.82 40.98 34 5 ASP A 96 ? ? 178.91 178.21 35 5 LYS A 98 ? ? -90.35 -60.71 36 5 ASN A 125 ? ? -58.12 -71.91 37 5 GLN A 130 ? ? -68.75 -172.64 38 6 ARG A 4 ? ? -58.37 -176.26 39 6 ALA A 5 ? ? 64.88 154.82 40 6 LYS A 18 ? ? -63.74 -70.47 41 6 ALA A 45 ? ? 55.56 18.89 42 6 ASP A 96 ? ? 176.83 -179.17 43 6 SER A 126 ? ? 56.29 86.33 44 6 GLN A 127 ? ? -173.98 130.57 45 6 ASN A 131 ? ? -115.23 -70.01 46 7 ALA A 3 ? ? -153.11 -41.28 47 7 ALA A 5 ? ? -104.07 -168.33 48 7 SER A 6 ? ? 61.20 70.01 49 7 ALA A 45 ? ? 90.13 2.15 50 7 THR A 70 ? ? -145.41 40.00 51 7 SER A 72 ? ? -57.64 172.69 52 7 ASP A 96 ? ? 177.93 178.82 53 7 GLU A 99 ? ? -72.87 -74.48 54 7 ALA A 100 ? ? -33.60 -39.74 55 7 LYS A 114 ? ? -160.04 26.75 56 7 ALA A 115 ? ? -137.78 -44.21 57 7 ALA A 119 ? ? -155.84 29.45 58 8 ALA A 5 ? ? -126.26 -169.63 59 8 SER A 6 ? ? 63.10 78.15 60 8 ALA A 45 ? ? 58.30 18.38 61 8 GLU A 52 ? ? -108.48 47.26 62 8 THR A 53 ? ? -178.40 112.96 63 8 SER A 72 ? ? -102.46 -163.43 64 8 ALA A 119 ? ? -100.87 -168.12 65 8 ASN A 124 ? ? -165.24 40.19 66 8 SER A 126 ? ? -157.16 -67.91 67 8 SER A 129 ? ? -131.90 -54.13 68 8 GLN A 130 ? ? 60.32 178.13 69 8 ASN A 131 ? ? -174.78 39.99 70 9 ARG A 4 ? ? -142.37 34.63 71 9 ALA A 5 ? ? -61.91 -169.62 72 9 LYS A 18 ? ? -63.99 -70.91 73 9 ALA A 45 ? ? 56.41 19.75 74 9 SER A 72 ? ? -91.21 -159.61 75 9 ASP A 96 ? ? 177.76 179.66 76 9 ALA A 115 ? ? -156.10 31.32 77 9 ALA A 120 ? ? -171.43 39.31 78 9 GLN A 127 ? ? -157.24 29.51 79 10 ALA A 3 ? ? -128.90 -66.13 80 10 SER A 6 ? ? 64.53 87.99 81 10 LYS A 18 ? ? -63.96 -70.51 82 10 ASP A 96 ? ? 178.50 178.92 83 10 GLU A 99 ? ? -74.97 -76.67 84 10 ALA A 100 ? ? -38.71 -35.43 85 10 SER A 111 ? ? -99.00 32.51 86 10 ALA A 118 ? ? -144.67 -59.17 87 10 ASN A 131 ? ? -135.88 -45.06 88 11 SER A 6 ? ? 66.21 62.32 89 11 LYS A 18 ? ? -63.90 -70.35 90 11 ALA A 45 ? ? 58.08 18.62 91 11 SER A 72 ? ? -92.75 -159.11 92 11 ASP A 96 ? ? 176.33 -178.86 93 11 SER A 111 ? ? -98.89 30.31 94 11 ALA A 115 ? ? -151.38 36.77 95 11 ALA A 119 ? ? -99.87 38.73 96 12 ALA A 3 ? ? -158.31 -57.35 97 12 VAL A 7 ? ? -129.42 -51.26 98 12 SER A 9 ? ? -78.47 -168.11 99 12 SER A 72 ? ? -56.63 178.47 100 12 LYS A 95 ? ? -78.16 -71.00 101 12 ALA A 120 ? ? -158.26 29.34 102 13 ALA A 3 ? ? -142.74 55.98 103 13 ARG A 4 ? ? 61.35 86.69 104 13 GLU A 52 ? ? -100.48 46.61 105 13 THR A 53 ? ? -175.39 116.89 106 13 SER A 72 ? ? -50.28 170.85 107 13 LYS A 98 ? ? -90.59 -60.70 108 13 SER A 111 ? ? -97.97 -75.74 109 13 LYS A 113 ? ? -171.54 -38.42 110 13 GLN A 116 ? ? -154.69 62.90 111 13 ASN A 124 ? ? -171.95 -172.79 112 14 ARG A 4 ? ? 57.90 90.62 113 14 ALA A 5 ? ? -59.09 -174.28 114 14 SER A 6 ? ? 64.02 96.06 115 14 VAL A 7 ? ? -91.51 -77.53 116 14 LEU A 8 ? ? -15.98 114.31 117 14 ALA A 45 ? ? 57.78 19.55 118 14 ASP A 96 ? ? 177.28 179.91 119 14 LYS A 98 ? ? -93.04 -63.86 120 14 GLN A 116 ? ? -139.36 -75.66 121 14 ASP A 121 ? ? -121.71 -65.14 122 14 ASN A 124 ? ? -128.91 -74.17 123 14 GLN A 127 ? ? 59.89 175.05 124 15 ARG A 4 ? ? -149.91 56.95 125 15 SER A 6 ? ? 59.14 100.16 126 15 VAL A 7 ? ? -91.38 -77.57 127 15 LEU A 8 ? ? -15.41 113.32 128 15 ALA A 45 ? ? 86.02 8.91 129 15 THR A 70 ? ? -143.70 50.30 130 15 SER A 72 ? ? -54.04 173.28 131 15 LYS A 112 ? ? -123.90 -50.48 132 15 ALA A 118 ? ? -99.64 32.14 133 15 ALA A 119 ? ? -160.47 29.31 134 15 ALA A 120 ? ? -150.76 25.46 135 15 ASP A 121 ? ? -108.85 54.13 136 15 VAL A 128 ? ? -175.53 142.25 137 16 ARG A 4 ? ? -157.84 44.82 138 16 VAL A 7 ? ? -132.84 -41.30 139 16 ALA A 45 ? ? 92.53 10.28 140 16 GLN A 90 ? ? -78.76 22.69 141 16 ARG A 91 ? ? 80.69 -18.01 142 16 VAL A 94 ? ? -34.84 124.53 143 16 ALA A 120 ? ? -136.43 -43.85 144 16 GLN A 127 ? ? -173.23 119.67 145 17 ARG A 4 ? ? 69.08 -75.47 146 17 ALA A 5 ? ? 60.04 -179.67 147 17 SER A 6 ? ? -164.19 98.22 148 17 ALA A 45 ? ? 55.60 18.10 149 17 THR A 70 ? ? -145.23 44.82 150 17 GLN A 116 ? ? -166.60 38.58 151 17 ALA A 119 ? ? -157.78 42.12 152 17 ALA A 120 ? ? -165.28 63.98 153 17 ASP A 121 ? ? -150.15 -46.71 154 18 ALA A 3 ? ? -164.86 -49.11 155 18 ALA A 45 ? ? 59.03 18.42 156 18 GLU A 52 ? ? -108.47 48.69 157 18 THR A 53 ? ? -176.47 115.80 158 18 THR A 70 ? ? -99.77 44.90 159 18 SER A 111 ? ? -96.21 32.32 160 18 ALA A 115 ? ? -143.37 25.22 161 18 GLN A 116 ? ? -159.76 30.92 162 18 ALA A 119 ? ? -175.94 36.43 163 18 ALA A 120 ? ? -170.09 -38.82 164 19 SER A 6 ? ? -170.29 42.60 165 19 ALA A 45 ? ? 92.07 6.46 166 19 SER A 72 ? ? -52.55 171.37 167 19 ARG A 91 ? ? 91.36 -26.82 168 19 VAL A 94 ? ? -33.95 146.52 169 19 ALA A 115 ? ? -95.69 31.09 170 19 GLN A 116 ? ? -159.27 28.94 171 19 GLN A 117 ? ? -129.01 -55.84 172 20 ARG A 4 ? ? 60.95 -177.06 173 20 SER A 6 ? ? 179.61 34.62 174 20 SER A 9 ? ? -79.45 -168.22 175 20 ILE A 19 ? ? -43.27 151.67 176 20 GLU A 52 ? ? -99.29 46.29 177 20 THR A 53 ? ? -177.33 120.00 178 20 SER A 72 ? ? -57.87 -178.26 179 20 LYS A 114 ? ? -93.56 -69.47 180 20 ALA A 119 ? ? -149.16 43.84 181 20 ALA A 120 ? ? -154.32 27.80 182 20 GLN A 127 ? ? 61.38 99.12 183 20 ASN A 131 ? ? -169.12 60.77 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'MYRISTIC ACID' _pdbx_entity_nonpoly.comp_id MYR #