data_2H5K # _entry.id 2H5K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2H5K RCSB RCSB037956 WWPDB D_1000037956 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2H46 _pdbx_database_related.details 'Native Domain-Swapped Dimeric Grb2-SH2' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2H5K _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-05-26 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Benfield, A.P.' 1 'Whiddon, B.B.' 2 'Martin, S.F.' 3 # _citation.id primary _citation.title 'Structural and energetic aspects of Grb2-SH2 domain-swapping.' _citation.journal_abbrev Arch.Biochem.Biophys. _citation.journal_volume 462 _citation.page_first 47 _citation.page_last 53 _citation.year 2007 _citation.journal_id_ASTM ABBIA4 _citation.country US _citation.journal_id_ISSN 0003-9861 _citation.journal_id_CSD 0158 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17466257 _citation.pdbx_database_id_DOI 10.1016/j.abb.2007.03.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Benfield, A.P.' 1 primary 'Whiddon, B.B.' 2 primary 'Clements, J.H.' 3 primary 'Martin, S.F.' 4 # _cell.entry_id 2H5K _cell.length_a 94.859 _cell.length_b 94.859 _cell.length_c 139.236 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2H5K _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 13687.465 2 ? ? 'SH2 Domain' ? 2 polymer syn 'Shc-Derived Ligand' 498.447 1 ? ? ? ? 3 non-polymer syn 'CACODYLATE ION' 136.989 1 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH ; ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH ; A,B ? 2 'polypeptide(L)' no yes '(ACE)(PTR)VN(NH2)' XYVNX C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLU n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 HIS n 1 7 PRO n 1 8 TRP n 1 9 PHE n 1 10 PHE n 1 11 GLY n 1 12 LYS n 1 13 ILE n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 LEU n 1 23 SER n 1 24 LYS n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 LEU n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 SER n 1 37 GLU n 1 38 SER n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 PHE n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 LEU n 1 60 ARG n 1 61 ASP n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 LYS n 1 66 TYR n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 VAL n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 TYR n 1 83 HIS n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ASN n 1 92 GLN n 1 93 GLN n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 PRO n 1 104 GLN n 1 105 GLN n 1 106 PRO n 1 107 THR n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 2 1 ACE n 2 2 PTR n 2 3 VAL n 2 4 ASN n 2 5 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'chemically synthesized' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP GRB2_HUMAN P62993 1 53 ? ? 2 PDB 2H5K 2H5K 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2H5K A 1 ? 110 ? P62993 53 ? 162 ? 53 162 2 1 2H5K B 1 ? 110 ? P62993 53 ? 162 ? 53 162 3 2 2H5K C 1 ? 5 ? 2H5K 0 ? 4 ? 0 4 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2H5K HIS A 111 ? UNP P62993 ? ? 'EXPRESSION TAG' 163 1 1 2H5K HIS A 112 ? UNP P62993 ? ? 'EXPRESSION TAG' 164 2 1 2H5K HIS A 113 ? UNP P62993 ? ? 'EXPRESSION TAG' 165 3 1 2H5K HIS A 114 ? UNP P62993 ? ? 'EXPRESSION TAG' 166 4 1 2H5K HIS A 115 ? UNP P62993 ? ? 'EXPRESSION TAG' 167 5 1 2H5K HIS A 116 ? UNP P62993 ? ? 'EXPRESSION TAG' 168 6 2 2H5K HIS B 111 ? UNP P62993 ? ? 'EXPRESSION TAG' 163 7 2 2H5K HIS B 112 ? UNP P62993 ? ? 'EXPRESSION TAG' 164 8 2 2H5K HIS B 113 ? UNP P62993 ? ? 'EXPRESSION TAG' 165 9 2 2H5K HIS B 114 ? UNP P62993 ? ? 'EXPRESSION TAG' 166 10 2 2H5K HIS B 115 ? UNP P62993 ? ? 'EXPRESSION TAG' 167 11 2 2H5K HIS B 116 ? UNP P62993 ? ? 'EXPRESSION TAG' 168 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAC non-polymer . 'CACODYLATE ION' dimethylarsinate 'C2 H6 As O2 -1' 136.989 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2H5K _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 62.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;Protein-ligand solution in 25 mM sodium cacodylate, pH 6.0 mixed with equal volume of 0.1 M sodium cacodylate, 0.1 M calcium acetate, 18% PEG 8000, pH 6.0., VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2004-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 2H5K _reflns.d_resolution_high 3.25 _reflns.d_resolution_low 20.000 _reflns.number_obs 6291 _reflns.pdbx_Rmerge_I_obs 0.156 _reflns.pdbx_netI_over_sigmaI 8.500 _reflns.pdbx_chi_squared 1.475 _reflns.pdbx_redundancy 6.900 _reflns.percent_possible_obs 99.000 _reflns.observed_criterion_sigma_F 1.0 _reflns.observed_criterion_sigma_I 1.0 _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.25 _reflns_shell.d_res_low 3.37 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.409 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.578 _reflns_shell.pdbx_redundancy 7.10 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 608 _reflns_shell.percent_possible_all 98.90 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2H5K _refine.ls_d_res_high 3.250 _refine.ls_d_res_low 20.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 98.800 _refine.ls_number_reflns_obs 6274 _refine.ls_R_factor_R_work 0.2469 _refine.ls_R_factor_R_free 0.2997 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 341 _refine.B_iso_mean 39.681 _refine.solvent_model_param_bsol 10.455 _refine.aniso_B[1][1] -0.463 _refine.aniso_B[2][2] -0.463 _refine.aniso_B[3][3] 0.926 _refine.aniso_B[1][2] -13.665 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.overall_FOM_work_R_set 0.777 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1617 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1631 _refine_hist.d_res_high 3.250 _refine_hist.d_res_low 20.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.010 ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? 1.481 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.492 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 1.771 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.698 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 3.026 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 3.250 3.290 8 . 776 . 0.328 0.347 . 43 . . 819 . 'X-RAY DIFFRACTION' 3.290 3.470 8 . 770 . 0.291 0.316 . 40 . . 810 . 'X-RAY DIFFRACTION' 3.470 3.680 8 . 777 . 0.236 0.356 . 58 . . 835 . 'X-RAY DIFFRACTION' 3.680 3.970 8 . 787 . 0.241 0.29 . 41 . . 828 . 'X-RAY DIFFRACTION' 3.970 4.370 8 . 794 . 0.22 0.19 . 42 . . 836 . 'X-RAY DIFFRACTION' 4.370 4.990 8 . 814 . 0.219 0.306 . 43 . . 857 . 'X-RAY DIFFRACTION' 4.990 6.280 8 . 830 . 0.247 0.34 . 44 . . 874 . 'X-RAY DIFFRACTION' 6.280 30.000 8 . 887 . 0.259 0.325 . 30 . . 917 . 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 pyvn.param pyvn.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' 5 cac_xplor_par.param cac_xplor_top.top 'X-RAY DIFFRACTION' # _struct.entry_id 2H5K _struct.title 'Crystal Structure of Complex Between the Domain-Swapped Dimeric Grb2 SH2 Domain and Shc-Derived Ligand, Ac-NH-pTyr-Val-Asn-NH2' _struct.pdbx_descriptor 'Growth factor receptor-bound protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2H5K _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'Domain-swapping, protein-phosphopeptide complex, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details 'The asymmetric unit is the biological unit and equals one domain-swapped dimer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 14 ? GLN A 25 ? PRO A 66 GLN A 77 1 ? 12 HELX_P HELX_P2 2 SER A 75 ? THR A 86 ? SER A 127 THR A 138 1 ? 12 HELX_P HELX_P3 3 PRO B 14 ? SER B 23 ? PRO B 66 SER B 75 1 ? 10 HELX_P HELX_P4 4 SER B 75 ? HIS B 83 ? SER B 127 HIS B 135 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? C ACE 1 C ? ? ? 1_555 C PTR 2 N ? ? C ACE 0 C PTR 1 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? C ASN 4 C ? ? ? 1_555 C NH2 5 N ? ? C ASN 3 C NH2 4 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? C PTR 2 C ? ? ? 1_555 C VAL 3 N ? ? C PTR 1 C VAL 2 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 31 ? GLU A 35 ? PHE A 83 GLU A 87 A 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101 A 3 ASP A 52 ? ARG A 60 ? ASP A 104 ARG A 112 A 4 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119 B 1 PHE B 31 ? GLU B 35 ? PHE B 83 GLU B 87 B 2 PHE B 43 ? PHE B 49 ? PHE B 95 PHE B 101 B 3 ASP B 52 ? LYS B 57 ? ASP B 104 LYS B 109 C 1 LEU B 59 ? ARG B 60 ? LEU B 111 ARG B 112 C 2 TYR B 66 ? PHE B 67 ? TYR B 118 PHE B 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 34 ? N ARG A 86 O SER A 44 ? O SER A 96 A 2 3 N VAL A 47 ? N VAL A 99 O GLN A 54 ? O GLN A 106 A 3 4 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119 B 1 2 N ARG B 34 ? N ARG B 86 O SER B 44 ? O SER B 96 B 2 3 N LEU B 45 ? N LEU B 97 O PHE B 56 ? O PHE B 108 C 1 2 N LEU B 59 ? N LEU B 111 O PHE B 67 ? O PHE B 119 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CAC B 10' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG B 15 ? ARG B 67 . ? 1_555 ? 2 AC1 6 ARG B 34 ? ARG B 86 . ? 1_555 ? 3 AC1 6 SER B 36 ? SER B 88 . ? 1_555 ? 4 AC1 6 GLU B 37 ? GLU B 89 . ? 1_555 ? 5 AC1 6 SER B 38 ? SER B 90 . ? 1_555 ? 6 AC1 6 SER B 44 ? SER B 96 . ? 1_555 ? # _atom_sites.entry_id 2H5K _atom_sites.fract_transf_matrix[1][1] 0.010542 _atom_sites.fract_transf_matrix[1][2] 0.006086 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012173 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007182 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AS C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 53 ? ? ? A . n A 1 2 GLU 2 54 ? ? ? A . n A 1 3 MET 3 55 ? ? ? A . n A 1 4 LYS 4 56 ? ? ? A . n A 1 5 PRO 5 57 57 PRO PRO A . n A 1 6 HIS 6 58 58 HIS HIS A . n A 1 7 PRO 7 59 59 PRO PRO A . n A 1 8 TRP 8 60 60 TRP TRP A . n A 1 9 PHE 9 61 61 PHE PHE A . n A 1 10 PHE 10 62 62 PHE PHE A . n A 1 11 GLY 11 63 63 GLY GLY A . n A 1 12 LYS 12 64 64 LYS LYS A . n A 1 13 ILE 13 65 65 ILE ILE A . n A 1 14 PRO 14 66 66 PRO PRO A . n A 1 15 ARG 15 67 67 ARG ARG A . n A 1 16 ALA 16 68 68 ALA ALA A . n A 1 17 LYS 17 69 69 LYS LYS A . n A 1 18 ALA 18 70 70 ALA ALA A . n A 1 19 GLU 19 71 71 GLU GLU A . n A 1 20 GLU 20 72 72 GLU GLU A . n A 1 21 MET 21 73 73 MET MET A . n A 1 22 LEU 22 74 74 LEU LEU A . n A 1 23 SER 23 75 75 SER SER A . n A 1 24 LYS 24 76 76 LYS LYS A . n A 1 25 GLN 25 77 77 GLN GLN A . n A 1 26 ARG 26 78 78 ARG ARG A . n A 1 27 HIS 27 79 79 HIS HIS A . n A 1 28 ASP 28 80 80 ASP ASP A . n A 1 29 GLY 29 81 81 GLY GLY A . n A 1 30 ALA 30 82 82 ALA ALA A . n A 1 31 PHE 31 83 83 PHE PHE A . n A 1 32 LEU 32 84 84 LEU LEU A . n A 1 33 ILE 33 85 85 ILE ILE A . n A 1 34 ARG 34 86 86 ARG ARG A . n A 1 35 GLU 35 87 87 GLU GLU A . n A 1 36 SER 36 88 88 SER SER A . n A 1 37 GLU 37 89 89 GLU GLU A . n A 1 38 SER 38 90 90 SER SER A . n A 1 39 ALA 39 91 91 ALA ALA A . n A 1 40 PRO 40 92 92 PRO PRO A . n A 1 41 GLY 41 93 93 GLY GLY A . n A 1 42 ASP 42 94 94 ASP ASP A . n A 1 43 PHE 43 95 95 PHE PHE A . n A 1 44 SER 44 96 96 SER SER A . n A 1 45 LEU 45 97 97 LEU LEU A . n A 1 46 SER 46 98 98 SER SER A . n A 1 47 VAL 47 99 99 VAL VAL A . n A 1 48 LYS 48 100 100 LYS LYS A . n A 1 49 PHE 49 101 101 PHE PHE A . n A 1 50 GLY 50 102 102 GLY GLY A . n A 1 51 ASN 51 103 103 ASN ASN A . n A 1 52 ASP 52 104 104 ASP ASP A . n A 1 53 VAL 53 105 105 VAL VAL A . n A 1 54 GLN 54 106 106 GLN GLN A . n A 1 55 HIS 55 107 107 HIS HIS A . n A 1 56 PHE 56 108 108 PHE PHE A . n A 1 57 LYS 57 109 109 LYS LYS A . n A 1 58 VAL 58 110 110 VAL VAL A . n A 1 59 LEU 59 111 111 LEU LEU A . n A 1 60 ARG 60 112 112 ARG ARG A . n A 1 61 ASP 61 113 113 ASP ASP A . n A 1 62 GLY 62 114 114 GLY GLY A . n A 1 63 ALA 63 115 115 ALA ALA A . n A 1 64 GLY 64 116 116 GLY GLY A . n A 1 65 LYS 65 117 117 LYS LYS A . n A 1 66 TYR 66 118 118 TYR TYR A . n A 1 67 PHE 67 119 119 PHE PHE A . n A 1 68 LEU 68 120 120 LEU LEU A . n A 1 69 TRP 69 121 121 TRP TRP A . n A 1 70 VAL 70 122 122 VAL VAL A . n A 1 71 VAL 71 123 123 VAL VAL A . n A 1 72 LYS 72 124 124 LYS LYS A . n A 1 73 PHE 73 125 125 PHE PHE A . n A 1 74 ASN 74 126 126 ASN ASN A . n A 1 75 SER 75 127 127 SER SER A . n A 1 76 LEU 76 128 128 LEU LEU A . n A 1 77 ASN 77 129 129 ASN ASN A . n A 1 78 GLU 78 130 130 GLU GLU A . n A 1 79 LEU 79 131 131 LEU LEU A . n A 1 80 VAL 80 132 132 VAL VAL A . n A 1 81 ASP 81 133 133 ASP ASP A . n A 1 82 TYR 82 134 134 TYR TYR A . n A 1 83 HIS 83 135 135 HIS HIS A . n A 1 84 ARG 84 136 136 ARG ARG A . n A 1 85 SER 85 137 137 SER SER A . n A 1 86 THR 86 138 138 THR THR A . n A 1 87 SER 87 139 139 SER SER A . n A 1 88 VAL 88 140 140 VAL VAL A . n A 1 89 SER 89 141 141 SER SER A . n A 1 90 ARG 90 142 142 ARG ARG A . n A 1 91 ASN 91 143 143 ASN ASN A . n A 1 92 GLN 92 144 144 GLN GLN A . n A 1 93 GLN 93 145 145 GLN GLN A . n A 1 94 ILE 94 146 146 ILE ILE A . n A 1 95 PHE 95 147 147 PHE PHE A . n A 1 96 LEU 96 148 148 LEU LEU A . n A 1 97 ARG 97 149 149 ARG ARG A . n A 1 98 ASP 98 150 150 ASP ASP A . n A 1 99 ILE 99 151 151 ILE ILE A . n A 1 100 GLU 100 152 152 GLU GLU A . n A 1 101 GLN 101 153 ? ? ? A . n A 1 102 VAL 102 154 ? ? ? A . n A 1 103 PRO 103 155 ? ? ? A . n A 1 104 GLN 104 156 ? ? ? A . n A 1 105 GLN 105 157 ? ? ? A . n A 1 106 PRO 106 158 ? ? ? A . n A 1 107 THR 107 159 ? ? ? A . n A 1 108 TYR 108 160 ? ? ? A . n A 1 109 VAL 109 161 ? ? ? A . n A 1 110 GLN 110 162 ? ? ? A . n A 1 111 HIS 111 163 ? ? ? A . n A 1 112 HIS 112 164 ? ? ? A . n A 1 113 HIS 113 165 ? ? ? A . n A 1 114 HIS 114 166 ? ? ? A . n A 1 115 HIS 115 167 ? ? ? A . n A 1 116 HIS 116 168 ? ? ? A . n B 1 1 ILE 1 53 ? ? ? B . n B 1 2 GLU 2 54 ? ? ? B . n B 1 3 MET 3 55 ? ? ? B . n B 1 4 LYS 4 56 ? ? ? B . n B 1 5 PRO 5 57 57 PRO PRO B . n B 1 6 HIS 6 58 58 HIS HIS B . n B 1 7 PRO 7 59 59 PRO PRO B . n B 1 8 TRP 8 60 60 TRP TRP B . n B 1 9 PHE 9 61 61 PHE PHE B . n B 1 10 PHE 10 62 62 PHE PHE B . n B 1 11 GLY 11 63 63 GLY GLY B . n B 1 12 LYS 12 64 64 LYS LYS B . n B 1 13 ILE 13 65 65 ILE ILE B . n B 1 14 PRO 14 66 66 PRO PRO B . n B 1 15 ARG 15 67 67 ARG ARG B . n B 1 16 ALA 16 68 68 ALA ALA B . n B 1 17 LYS 17 69 69 LYS LYS B . n B 1 18 ALA 18 70 70 ALA ALA B . n B 1 19 GLU 19 71 71 GLU GLU B . n B 1 20 GLU 20 72 72 GLU GLU B . n B 1 21 MET 21 73 73 MET MET B . n B 1 22 LEU 22 74 74 LEU LEU B . n B 1 23 SER 23 75 75 SER SER B . n B 1 24 LYS 24 76 76 LYS LYS B . n B 1 25 GLN 25 77 77 GLN GLN B . n B 1 26 ARG 26 78 78 ARG ARG B . n B 1 27 HIS 27 79 79 HIS HIS B . n B 1 28 ASP 28 80 80 ASP ASP B . n B 1 29 GLY 29 81 81 GLY GLY B . n B 1 30 ALA 30 82 82 ALA ALA B . n B 1 31 PHE 31 83 83 PHE PHE B . n B 1 32 LEU 32 84 84 LEU LEU B . n B 1 33 ILE 33 85 85 ILE ILE B . n B 1 34 ARG 34 86 86 ARG ARG B . n B 1 35 GLU 35 87 87 GLU GLU B . n B 1 36 SER 36 88 88 SER SER B . n B 1 37 GLU 37 89 89 GLU GLU B . n B 1 38 SER 38 90 90 SER SER B . n B 1 39 ALA 39 91 91 ALA ALA B . n B 1 40 PRO 40 92 92 PRO PRO B . n B 1 41 GLY 41 93 93 GLY GLY B . n B 1 42 ASP 42 94 94 ASP ASP B . n B 1 43 PHE 43 95 95 PHE PHE B . n B 1 44 SER 44 96 96 SER SER B . n B 1 45 LEU 45 97 97 LEU LEU B . n B 1 46 SER 46 98 98 SER SER B . n B 1 47 VAL 47 99 99 VAL VAL B . n B 1 48 LYS 48 100 100 LYS LYS B . n B 1 49 PHE 49 101 101 PHE PHE B . n B 1 50 GLY 50 102 102 GLY GLY B . n B 1 51 ASN 51 103 103 ASN ASN B . n B 1 52 ASP 52 104 104 ASP ASP B . n B 1 53 VAL 53 105 105 VAL VAL B . n B 1 54 GLN 54 106 106 GLN GLN B . n B 1 55 HIS 55 107 107 HIS HIS B . n B 1 56 PHE 56 108 108 PHE PHE B . n B 1 57 LYS 57 109 109 LYS LYS B . n B 1 58 VAL 58 110 110 VAL VAL B . n B 1 59 LEU 59 111 111 LEU LEU B . n B 1 60 ARG 60 112 112 ARG ARG B . n B 1 61 ASP 61 113 113 ASP ASP B . n B 1 62 GLY 62 114 114 GLY GLY B . n B 1 63 ALA 63 115 115 ALA ALA B . n B 1 64 GLY 64 116 116 GLY GLY B . n B 1 65 LYS 65 117 117 LYS LYS B . n B 1 66 TYR 66 118 118 TYR TYR B . n B 1 67 PHE 67 119 119 PHE PHE B . n B 1 68 LEU 68 120 120 LEU LEU B . n B 1 69 TRP 69 121 121 TRP TRP B . n B 1 70 VAL 70 122 122 VAL VAL B . n B 1 71 VAL 71 123 123 VAL VAL B . n B 1 72 LYS 72 124 124 LYS LYS B . n B 1 73 PHE 73 125 125 PHE PHE B . n B 1 74 ASN 74 126 126 ASN ASN B . n B 1 75 SER 75 127 127 SER SER B . n B 1 76 LEU 76 128 128 LEU LEU B . n B 1 77 ASN 77 129 129 ASN ASN B . n B 1 78 GLU 78 130 130 GLU GLU B . n B 1 79 LEU 79 131 131 LEU LEU B . n B 1 80 VAL 80 132 132 VAL VAL B . n B 1 81 ASP 81 133 133 ASP ASP B . n B 1 82 TYR 82 134 134 TYR TYR B . n B 1 83 HIS 83 135 135 HIS HIS B . n B 1 84 ARG 84 136 136 ARG ARG B . n B 1 85 SER 85 137 137 SER SER B . n B 1 86 THR 86 138 138 THR THR B . n B 1 87 SER 87 139 139 SER SER B . n B 1 88 VAL 88 140 140 VAL VAL B . n B 1 89 SER 89 141 141 SER SER B . n B 1 90 ARG 90 142 142 ARG ARG B . n B 1 91 ASN 91 143 143 ASN ASN B . n B 1 92 GLN 92 144 144 GLN GLN B . n B 1 93 GLN 93 145 145 GLN GLN B . n B 1 94 ILE 94 146 146 ILE ILE B . n B 1 95 PHE 95 147 147 PHE PHE B . n B 1 96 LEU 96 148 148 LEU LEU B . n B 1 97 ARG 97 149 149 ARG ARG B . n B 1 98 ASP 98 150 150 ASP ASP B . n B 1 99 ILE 99 151 151 ILE ILE B . n B 1 100 GLU 100 152 152 GLU GLU B . n B 1 101 GLN 101 153 ? ? ? B . n B 1 102 VAL 102 154 ? ? ? B . n B 1 103 PRO 103 155 ? ? ? B . n B 1 104 GLN 104 156 ? ? ? B . n B 1 105 GLN 105 157 ? ? ? B . n B 1 106 PRO 106 158 ? ? ? B . n B 1 107 THR 107 159 ? ? ? B . n B 1 108 TYR 108 160 ? ? ? B . n B 1 109 VAL 109 161 ? ? ? B . n B 1 110 GLN 110 162 ? ? ? B . n B 1 111 HIS 111 163 ? ? ? B . n B 1 112 HIS 112 164 ? ? ? B . n B 1 113 HIS 113 165 ? ? ? B . n B 1 114 HIS 114 166 ? ? ? B . n B 1 115 HIS 115 167 ? ? ? B . n B 1 116 HIS 116 168 ? ? ? B . n C 2 1 ACE 1 0 0 ACE ACE C . n C 2 2 PTR 2 1 1 PTR PTR C . n C 2 3 VAL 3 2 2 VAL VAL C . n C 2 4 ASN 4 3 3 ASN ASN C . n C 2 5 NH2 5 4 4 NH2 NH2 C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 CAC 1 10 10 CAC CAC B . E 4 HOH 1 1 1 HOH HOH A . E 4 HOH 2 2 2 HOH HOH A . E 4 HOH 3 3 3 HOH HOH A . E 4 HOH 4 5 5 HOH HOH A . E 4 HOH 5 8 8 HOH HOH A . E 4 HOH 6 9 9 HOH HOH A . F 4 HOH 1 4 4 HOH HOH B . F 4 HOH 2 6 6 HOH HOH B . F 4 HOH 3 7 7 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id C _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id C _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6250 ? 1 MORE -32 ? 1 'SSA (A^2)' 10820 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-15 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' # _pdbx_phasing_MR.entry_id 2H5K _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor 0.357 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc 0.681 _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.250 _pdbx_phasing_MR.d_res_low_rotation 19.700 _pdbx_phasing_MR.d_res_high_translation 3.250 _pdbx_phasing_MR.d_res_low_translation 19.700 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 MOLREP . ? other 'A. Vagin' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 3 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 4 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 CrystalClear '(MSC/RIGAKU)' ? ? ? ? 'data reduction' ? ? ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 64 ? ? -111.19 76.48 2 1 PRO A 92 ? ? -38.50 103.23 3 1 PHE A 101 ? ? -162.79 119.41 4 1 SER A 139 ? ? -47.24 156.25 5 1 PHE B 62 ? ? -80.34 30.17 6 1 GLN B 77 ? ? -38.64 139.08 7 1 ARG B 78 ? ? -93.46 33.11 8 1 SER B 90 ? ? -54.74 -87.77 9 1 PRO B 92 ? ? -53.35 171.33 10 1 PHE B 119 ? ? 179.57 150.94 11 1 TRP B 121 ? ? 177.62 154.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B GLU 152 ? C ? B GLU 100 C 2 1 Y 1 B GLU 152 ? O ? B GLU 100 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 53 ? A ILE 1 2 1 Y 1 A GLU 54 ? A GLU 2 3 1 Y 1 A MET 55 ? A MET 3 4 1 Y 1 A LYS 56 ? A LYS 4 5 1 Y 1 A GLN 153 ? A GLN 101 6 1 Y 1 A VAL 154 ? A VAL 102 7 1 Y 1 A PRO 155 ? A PRO 103 8 1 Y 1 A GLN 156 ? A GLN 104 9 1 Y 1 A GLN 157 ? A GLN 105 10 1 Y 1 A PRO 158 ? A PRO 106 11 1 Y 1 A THR 159 ? A THR 107 12 1 Y 1 A TYR 160 ? A TYR 108 13 1 Y 1 A VAL 161 ? A VAL 109 14 1 Y 1 A GLN 162 ? A GLN 110 15 1 Y 1 A HIS 163 ? A HIS 111 16 1 Y 1 A HIS 164 ? A HIS 112 17 1 Y 1 A HIS 165 ? A HIS 113 18 1 Y 1 A HIS 166 ? A HIS 114 19 1 Y 1 A HIS 167 ? A HIS 115 20 1 Y 1 A HIS 168 ? A HIS 116 21 1 Y 1 B ILE 53 ? B ILE 1 22 1 Y 1 B GLU 54 ? B GLU 2 23 1 Y 1 B MET 55 ? B MET 3 24 1 Y 1 B LYS 56 ? B LYS 4 25 1 Y 1 B GLN 153 ? B GLN 101 26 1 Y 1 B VAL 154 ? B VAL 102 27 1 Y 1 B PRO 155 ? B PRO 103 28 1 Y 1 B GLN 156 ? B GLN 104 29 1 Y 1 B GLN 157 ? B GLN 105 30 1 Y 1 B PRO 158 ? B PRO 106 31 1 Y 1 B THR 159 ? B THR 107 32 1 Y 1 B TYR 160 ? B TYR 108 33 1 Y 1 B VAL 161 ? B VAL 109 34 1 Y 1 B GLN 162 ? B GLN 110 35 1 Y 1 B HIS 163 ? B HIS 111 36 1 Y 1 B HIS 164 ? B HIS 112 37 1 Y 1 B HIS 165 ? B HIS 113 38 1 Y 1 B HIS 166 ? B HIS 114 39 1 Y 1 B HIS 167 ? B HIS 115 40 1 Y 1 B HIS 168 ? B HIS 116 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CACODYLATE ION' CAC 4 water HOH #