data_2H5M # _entry.id 2H5M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2H5M RCSB RCSB037958 WWPDB D_1000037958 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1R57 'structure of the same protein in the absence of bound ligand' unspecified TargetDB ZR31 . unspecified # _pdbx_database_status.entry_id 2H5M _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.recvd_initial_deposition_date 2006-05-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Ramelot, T.A.' 2 'Acton, T.B.' 3 'Ma, L.' 4 'Xiao, R.B.' 5 'Montelione, G.T.' 6 'Kennedy, M.A.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title ;Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins ; _citation.journal_abbrev J.Struct.Funct.Genom. _citation.journal_volume 9 _citation.page_first 7 _citation.page_last 20 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18709443 _citation.pdbx_database_id_DOI 10.1007/s10969-008-9041-z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cort, J.R.' 1 primary 'Ramelot, T.A.' 2 primary 'Murray, D.' 3 primary 'Acton, T.B.' 4 primary 'Ma, L.C.' 5 primary 'Xiao, R.' 6 primary 'Montelione, G.T.' 7 primary 'Kennedy, M.A.' 8 # _cell.entry_id 2H5M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2H5M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acetyltransferase, GNAT family' 11631.878 1 ? ? ? ? 2 non-polymer syn 'ACETYL COENZYME *A' 809.571 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SACOL2532 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKH MLEKEDSYQDVYLGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKH MLEKEDSYQDVYLGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ZR31 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 LEU n 1 5 GLU n 1 6 ILE n 1 7 LYS n 1 8 GLN n 1 9 GLY n 1 10 GLU n 1 11 ASN n 1 12 LYS n 1 13 PHE n 1 14 TYR n 1 15 ILE n 1 16 GLY n 1 17 ASP n 1 18 ASP n 1 19 GLU n 1 20 ASN n 1 21 ASN n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 GLU n 1 26 ILE n 1 27 THR n 1 28 TYR n 1 29 ARG n 1 30 PHE n 1 31 VAL n 1 32 ASP n 1 33 ASN n 1 34 ASN n 1 35 GLU n 1 36 ILE n 1 37 ASN n 1 38 ILE n 1 39 ASP n 1 40 HIS n 1 41 THR n 1 42 GLY n 1 43 VAL n 1 44 SER n 1 45 ASP n 1 46 GLU n 1 47 LEU n 1 48 GLY n 1 49 GLY n 1 50 GLN n 1 51 GLY n 1 52 VAL n 1 53 GLY n 1 54 LYS n 1 55 LYS n 1 56 LEU n 1 57 LEU n 1 58 LYS n 1 59 ALA n 1 60 VAL n 1 61 VAL n 1 62 GLU n 1 63 HIS n 1 64 ALA n 1 65 ARG n 1 66 GLU n 1 67 ASN n 1 68 ASN n 1 69 LEU n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 SER n 1 75 CYS n 1 76 SER n 1 77 PHE n 1 78 ALA n 1 79 LYS n 1 80 HIS n 1 81 MET n 1 82 LEU n 1 83 GLU n 1 84 LYS n 1 85 GLU n 1 86 ASP n 1 87 SER n 1 88 TYR n 1 89 GLN n 1 90 ASP n 1 91 VAL n 1 92 TYR n 1 93 LEU n 1 94 GLY n 1 95 LEU n 1 96 GLU n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene SACOL2532 _entity_src_gen.gene_src_species 'Staphylococcus aureus' _entity_src_gen.gene_src_strain COL _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 93062 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'construct provides C-terminal His Tag (8 residues)' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5HD32_STAAC _struct_ref.pdbx_db_accession Q5HD32 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2H5M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5HD32 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2H5M LEU A 95 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 95 1 1 2H5M GLU A 96 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 96 2 1 2H5M HIS A 97 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 97 3 1 2H5M HIS A 98 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 98 4 1 2H5M HIS A 99 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 99 5 1 2H5M HIS A 100 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 100 6 1 2H5M HIS A 101 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 101 7 1 2H5M HIS A 102 ? UNP Q5HD32 ? ? 'EXPRESSION TAG' 102 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACO non-polymer . 'ACETYL COENZYME *A' ? 'C23 H38 N7 O17 P3 S' 809.571 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '1H-15N HSQC' 1 2 2 4D_13C-separated_NOESY 2 3 2 '3D edited-filtered 1H-C13 NOESY HSQC' 2 4 2 '2D doubly C12-filtered 1H-1H NOESY' 2 5 2 '2D doubly C12-filtered 1H-1H TOCSY' 2 6 2 '1H-13C HSQC' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength .115 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM SACOL2532 U-15N,13C; 5 mM acetyl-CoA, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 0.02% NaN3' '5% D2O, 95% H2O' 2 '1 mM SACOL2532 U-15N,13C; 5 mM acetyl-CoA, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 0.02% NaN3' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 900 ? 2 INOVA Varian 800 ? 3 INOVA Varian 600 ? # _pdbx_nmr_refine.entry_id 2H5M _pdbx_nmr_refine.method 'Refinement was conducted with HADDOCK. Starting structures were the 1R57 ensemble, which is the protein in the absence of ligand' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2H5M _pdbx_nmr_details.text 'the sample contained isotope labeled protein and unlabeled ligand' # _pdbx_nmr_ensemble.entry_id 2H5M _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2H5M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'no criteria' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement HADDOCK 1.3 'A. Bonvin' 1 'data analysis' FELIX 97 MSI 2 # _exptl.entry_id 2H5M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2H5M _struct.title ;NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus complexed with acetyl-CoA. Northeast Structural Genomics Consortium Target ZR31 ; _struct.pdbx_descriptor 'Acetyltransferase, GNAT family' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2H5M _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;GNAT, N-acetyltransferase domain, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, transferase ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 51 ? ASN A 67 ? GLY A 51 ASN A 67 1 ? 17 HELX_P HELX_P2 2 CYS A 75 ? GLU A 85 ? CYS A 75 GLU A 85 1 ? 11 HELX_P HELX_P3 3 ASP A 86 ? GLN A 89 ? ASP A 86 GLN A 89 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 7 ? GLY A 9 ? LYS A 7 GLY A 9 A 2 LYS A 12 ? GLY A 16 ? LYS A 12 GLY A 16 A 3 ALA A 22 ? PHE A 30 ? ALA A 22 PHE A 30 A 4 GLU A 35 ? VAL A 43 ? GLU A 35 VAL A 43 A 5 LYS A 70 ? ALA A 73 ? LYS A 70 ALA A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 9 ? N GLY A 9 O LYS A 12 ? O LYS A 12 A 2 3 N PHE A 13 ? N PHE A 13 O ILE A 26 ? O ILE A 26 A 3 4 N ARG A 29 ? N ARG A 29 O ASN A 37 ? O ASN A 37 A 4 5 N ILE A 36 ? N ILE A 36 O LYS A 70 ? O LYS A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE ACO A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ASP A 39 ? ASP A 39 . ? 1_555 ? 2 AC1 11 THR A 41 ? THR A 41 . ? 1_555 ? 3 AC1 11 GLY A 42 ? GLY A 42 . ? 1_555 ? 4 AC1 11 VAL A 43 ? VAL A 43 . ? 1_555 ? 5 AC1 11 GLN A 50 ? GLN A 50 . ? 1_555 ? 6 AC1 11 LYS A 54 ? LYS A 54 . ? 1_555 ? 7 AC1 11 CYS A 75 ? CYS A 75 . ? 1_555 ? 8 AC1 11 SER A 76 ? SER A 76 . ? 1_555 ? 9 AC1 11 PHE A 77 ? PHE A 77 . ? 1_555 ? 10 AC1 11 HIS A 80 ? HIS A 80 . ? 1_555 ? 11 AC1 11 LYS A 84 ? LYS A 84 . ? 1_555 ? # _atom_sites.entry_id 2H5M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ACO _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 103 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ACO _pdbx_nonpoly_scheme.auth_mon_id ACO _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-28 2 'Structure model' 1 1 2007-12-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.57 2 1 HZ2 A LYS 12 ? ? OE2 A GLU 25 ? ? 1.59 3 1 HZ2 A LYS 58 ? ? OE2 A GLU 62 ? ? 1.59 4 3 HZ2 A LYS 7 ? ? HH A TYR 14 ? ? 1.10 5 3 HZ3 A LYS 12 ? ? OE2 A GLU 19 ? ? 1.58 6 3 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.59 7 5 HZ1 A LYS 58 ? ? OE2 A GLU 62 ? ? 1.57 8 5 HZ3 A LYS 12 ? ? OE1 A GLU 25 ? ? 1.60 9 6 HZ2 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.58 10 11 HZ3 A LYS 12 ? ? OE2 A GLU 19 ? ? 1.58 11 11 HZ1 A LYS 84 ? ? OE1 A GLU 85 ? ? 1.58 12 11 HZ3 A LYS 79 ? ? OE1 A GLU 83 ? ? 1.58 13 11 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.59 14 11 HZ2 A LYS 12 ? ? OE2 A GLU 25 ? ? 1.60 15 12 HZ3 A LYS 79 ? ? HH A TYR 92 ? ? 1.21 16 12 HZ1 A LYS 12 ? ? OE1 A GLU 19 ? ? 1.55 17 13 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.54 18 13 HZ3 A LYS 58 ? ? OE2 A GLU 62 ? ? 1.59 19 13 HZ2 A LYS 84 ? ? OE1 A GLU 85 ? ? 1.59 20 14 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.55 21 14 HZ2 A LYS 12 ? ? OE2 A GLU 25 ? ? 1.57 22 15 HZ3 A LYS 7 ? ? HH A TYR 14 ? ? 0.83 23 15 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.53 24 15 HZ2 A LYS 79 ? ? OE1 A GLU 83 ? ? 1.58 25 15 HZ3 A LYS 12 ? ? OE2 A GLU 19 ? ? 1.60 26 16 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.53 27 16 HZ1 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.58 28 17 HZ2 A LYS 84 ? ? OE1 A GLU 85 ? ? 1.59 29 18 HZ2 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.58 30 18 HZ2 A LYS 84 ? ? OE1 A GLU 85 ? ? 1.59 31 18 HZ3 A LYS 54 ? ? OE2 A GLU 85 ? ? 1.59 32 18 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.59 33 19 HZ1 A LYS 12 ? ? OE1 A GLU 19 ? ? 1.57 34 19 OE1 A GLU 83 ? ? HE2 A HIS 100 ? ? 1.59 35 20 HZ3 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.56 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 16 CE1 A TYR 88 ? ? CZ A TYR 88 ? ? 1.463 1.381 0.082 0.013 N 2 16 CZ A TYR 88 ? ? CE2 A TYR 88 ? ? 1.294 1.381 -0.087 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -143.87 -69.99 2 1 GLU A 10 ? ? -62.18 89.55 3 1 ASN A 21 ? ? -94.37 44.38 4 1 ASP A 32 ? ? -123.02 -85.68 5 1 ASN A 33 ? ? -130.66 -56.39 6 1 LEU A 47 ? ? -127.91 -68.33 7 1 GLN A 89 ? ? -82.24 32.49 8 1 HIS A 97 ? ? -179.77 -32.65 9 1 HIS A 99 ? ? 58.36 -171.47 10 1 HIS A 100 ? ? 59.78 -92.85 11 1 HIS A 101 ? ? -177.16 -53.26 12 2 GLU A 10 ? ? -64.48 95.41 13 2 ASP A 32 ? ? -129.30 -80.00 14 2 ASN A 33 ? ? -161.93 -50.75 15 2 ASP A 39 ? ? -64.18 -72.36 16 2 GLU A 46 ? ? -75.98 44.72 17 2 HIS A 99 ? ? 62.93 76.30 18 3 SER A 2 ? ? -126.80 -62.40 19 3 GLU A 10 ? ? -63.65 93.55 20 3 ASN A 21 ? ? -94.47 42.17 21 3 ASP A 32 ? ? -126.27 -86.99 22 3 ASN A 33 ? ? -129.76 -59.32 23 3 LEU A 93 ? ? -83.55 45.90 24 3 HIS A 97 ? ? -177.68 -38.79 25 3 HIS A 99 ? ? 56.68 -176.90 26 3 HIS A 100 ? ? 62.09 -84.65 27 3 HIS A 101 ? ? -167.42 -53.34 28 4 LEU A 4 ? ? -116.08 -100.13 29 4 GLU A 5 ? ? 69.18 137.52 30 4 ASP A 32 ? ? -144.30 33.05 31 4 ASN A 33 ? ? 67.85 -66.37 32 5 GLU A 10 ? ? -60.37 87.48 33 5 ALA A 24 ? ? -172.17 145.20 34 5 ASP A 32 ? ? -141.72 -88.73 35 5 ASN A 33 ? ? -151.47 -54.81 36 5 ASP A 39 ? ? -68.39 -74.25 37 5 GLU A 96 ? ? -102.54 66.52 38 6 ASN A 21 ? ? -102.71 44.71 39 7 LEU A 4 ? ? -122.89 -101.75 40 7 GLU A 5 ? ? 67.62 137.23 41 7 ASP A 32 ? ? -145.46 37.50 42 7 ASN A 33 ? ? 63.23 -73.03 43 7 HIS A 98 ? ? -69.22 94.77 44 8 LEU A 4 ? ? -93.72 -101.07 45 8 GLU A 5 ? ? 67.19 125.88 46 8 GLU A 10 ? ? 39.75 52.80 47 8 ASP A 32 ? ? -148.77 40.92 48 8 ASN A 33 ? ? 65.80 -68.00 49 8 LEU A 47 ? ? -140.16 11.63 50 9 SER A 2 ? ? 67.42 -79.43 51 9 ASN A 3 ? ? -170.67 22.15 52 9 GLU A 10 ? ? -67.88 95.87 53 9 ASP A 32 ? ? -152.90 -158.78 54 9 THR A 41 ? ? -154.43 85.55 55 9 GLU A 96 ? ? -111.56 -79.34 56 9 HIS A 101 ? ? -161.30 -44.77 57 10 LEU A 4 ? ? -133.36 -104.28 58 10 GLU A 5 ? ? 67.95 141.41 59 10 ASP A 32 ? ? -149.57 33.03 60 10 ASN A 33 ? ? 67.35 -72.65 61 11 SER A 2 ? ? -152.11 -68.98 62 11 LEU A 4 ? ? -92.36 56.88 63 11 GLU A 10 ? ? -59.28 92.64 64 11 ASN A 21 ? ? -95.73 40.31 65 11 ASP A 32 ? ? -132.00 -81.36 66 11 ASN A 33 ? ? -125.21 -78.80 67 11 HIS A 97 ? ? -171.38 -35.22 68 11 HIS A 99 ? ? 59.30 179.12 69 11 HIS A 100 ? ? 53.44 -94.47 70 11 HIS A 101 ? ? -147.62 -47.35 71 12 GLU A 10 ? ? -64.56 97.28 72 12 ASP A 32 ? ? -141.32 -79.41 73 12 ASN A 33 ? ? -158.93 -56.44 74 12 HIS A 97 ? ? -154.14 36.75 75 13 SER A 2 ? ? -96.09 -77.48 76 13 GLU A 10 ? ? -60.70 87.72 77 13 ASN A 21 ? ? -100.23 41.29 78 13 ASP A 32 ? ? -142.79 -76.04 79 13 ASN A 33 ? ? -134.38 -60.19 80 13 HIS A 97 ? ? -174.55 -37.01 81 13 HIS A 99 ? ? 58.27 -176.26 82 13 HIS A 100 ? ? 51.96 -107.91 83 13 HIS A 101 ? ? -135.72 -42.24 84 14 SER A 2 ? ? -139.00 -86.18 85 14 GLU A 10 ? ? -62.03 92.93 86 14 ASN A 21 ? ? -101.55 44.25 87 14 ASP A 32 ? ? -130.76 -88.89 88 14 ASN A 33 ? ? -126.31 -57.79 89 14 LEU A 93 ? ? -79.93 46.60 90 14 HIS A 97 ? ? -179.69 -35.17 91 14 HIS A 99 ? ? 61.70 172.67 92 14 HIS A 100 ? ? 59.65 -90.92 93 14 HIS A 101 ? ? -159.37 -31.82 94 15 SER A 2 ? ? -100.97 -78.86 95 15 GLU A 10 ? ? -60.26 91.76 96 15 ASP A 32 ? ? -131.93 -81.28 97 15 ASN A 33 ? ? -131.44 -70.04 98 15 HIS A 97 ? ? -178.29 -38.67 99 15 HIS A 99 ? ? 59.62 -177.50 100 15 HIS A 100 ? ? 56.82 -93.17 101 15 HIS A 101 ? ? -154.78 -41.81 102 16 SER A 2 ? ? -132.92 -72.38 103 16 GLU A 10 ? ? -61.74 89.41 104 16 ASN A 21 ? ? -96.59 44.24 105 16 ASP A 32 ? ? -125.71 -81.63 106 16 ASN A 33 ? ? -134.71 -60.87 107 16 HIS A 97 ? ? -179.93 -39.57 108 16 HIS A 99 ? ? 61.27 -178.50 109 16 HIS A 100 ? ? 59.47 -91.01 110 16 HIS A 101 ? ? -158.26 -66.84 111 17 GLU A 10 ? ? -65.80 94.84 112 17 ASP A 32 ? ? -136.60 -97.09 113 17 ASN A 33 ? ? -149.34 -49.74 114 17 ASN A 68 ? ? 60.67 63.62 115 17 HIS A 99 ? ? 73.68 94.73 116 17 HIS A 101 ? ? -116.00 76.51 117 18 SER A 2 ? ? -153.27 -77.73 118 18 GLU A 10 ? ? -63.33 90.22 119 18 ASN A 21 ? ? -96.42 41.08 120 18 ASP A 32 ? ? -139.47 -90.63 121 18 ASN A 33 ? ? -128.74 -60.99 122 18 HIS A 97 ? ? -175.00 -37.75 123 18 HIS A 99 ? ? 59.54 173.77 124 18 HIS A 100 ? ? 60.93 -88.39 125 18 HIS A 101 ? ? -158.02 -55.34 126 19 GLU A 10 ? ? -67.47 96.97 127 19 ASP A 32 ? ? -135.69 -84.04 128 19 ASN A 33 ? ? -152.51 -57.64 129 19 HIS A 97 ? ? -155.03 39.71 130 19 HIS A 99 ? ? 62.68 70.61 131 20 LEU A 4 ? ? -121.82 -104.30 132 20 GLU A 5 ? ? 66.22 133.88 133 20 ASP A 32 ? ? -148.11 47.00 134 20 ASN A 33 ? ? 60.70 -79.68 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ACETYL COENZYME *A' _pdbx_entity_nonpoly.comp_id ACO #