data_2H80 # _entry.id 2H80 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2H80 pdb_00002h80 10.2210/pdb2h80/pdb RCSB RCSB038044 ? ? WWPDB D_1000038044 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2H80 _pdbx_database_status.recvd_initial_deposition_date 2006-06-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.Y.' 1 'Fung, K.L.' 2 'Jin, D.Y.' 3 'Chung, S.S.' 4 'Ko, B.C.' 5 'Sun, H.Z.' 6 # _citation.id primary _citation.title 'Solution structures, dynamics, and lipid-binding of the sterile alpha-motif domain of the deleted in liver cancer 2' _citation.journal_abbrev Proteins _citation.journal_volume 67 _citation.page_first 1154 _citation.page_last 1166 _citation.year 2007 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17380510 _citation.pdbx_database_id_DOI 10.1002/prot.21361 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Fung, K.L.' 2 ? primary 'Jin, D.Y.' 3 ? primary 'Chung, S.S.' 4 ? primary 'Ching, Y.P.' 5 ? primary 'Ng, I.O.' 6 ? primary 'Sze, K.H.' 7 ? primary 'Ko, B.C.' 8 ? primary 'Sun, H.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'StAR-related lipid transfer protein 13' _entity.formula_weight 9339.574 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Deleted in liver cancer protein 2, DLC2, StARD13, START domain-containing protein 13, 46H23.2, Rho GTPase-activating protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGLVPRGSQEIEAKEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASM K ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGLVPRGSQEIEAKEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASM K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 PRO n 1 14 ARG n 1 15 GLY n 1 16 SER n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 GLU n 1 21 ALA n 1 22 LYS n 1 23 GLU n 1 24 ALA n 1 25 CYS n 1 26 ASP n 1 27 TRP n 1 28 LEU n 1 29 ARG n 1 30 ALA n 1 31 ALA n 1 32 GLY n 1 33 PHE n 1 34 PRO n 1 35 GLN n 1 36 TYR n 1 37 ALA n 1 38 GLN n 1 39 LEU n 1 40 TYR n 1 41 GLU n 1 42 ASP n 1 43 SER n 1 44 GLN n 1 45 PHE n 1 46 PRO n 1 47 ILE n 1 48 ASN n 1 49 ILE n 1 50 VAL n 1 51 ALA n 1 52 VAL n 1 53 LYS n 1 54 ASN n 1 55 ASP n 1 56 HIS n 1 57 ASP n 1 58 PHE n 1 59 LEU n 1 60 GLU n 1 61 LYS n 1 62 ASP n 1 63 LEU n 1 64 VAL n 1 65 GLU n 1 66 PRO n 1 67 LEU n 1 68 CYS n 1 69 ARG n 1 70 ARG n 1 71 LEU n 1 72 ASN n 1 73 THR n 1 74 LEU n 1 75 ASN n 1 76 LYS n 1 77 CYS n 1 78 ALA n 1 79 SER n 1 80 MET n 1 81 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-32 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STA13_HUMAN _struct_ref.pdbx_db_accession Q9Y3M8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QEIEAKEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMK _struct_ref.pdbx_align_begin 56 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2H80 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 17 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3M8 _struct_ref_seq.db_align_beg 56 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2H80 MET A 1 ? UNP Q9Y3M8 ? ? 'expression tag' 1 1 1 2H80 HIS A 2 ? UNP Q9Y3M8 ? ? 'expression tag' 2 2 1 2H80 HIS A 3 ? UNP Q9Y3M8 ? ? 'expression tag' 3 3 1 2H80 HIS A 4 ? UNP Q9Y3M8 ? ? 'expression tag' 4 4 1 2H80 HIS A 5 ? UNP Q9Y3M8 ? ? 'expression tag' 5 5 1 2H80 HIS A 6 ? UNP Q9Y3M8 ? ? 'expression tag' 6 6 1 2H80 HIS A 7 ? UNP Q9Y3M8 ? ? 'expression tag' 7 7 1 2H80 SER A 8 ? UNP Q9Y3M8 ? ? 'expression tag' 8 8 1 2H80 SER A 9 ? UNP Q9Y3M8 ? ? 'expression tag' 9 9 1 2H80 GLY A 10 ? UNP Q9Y3M8 ? ? 'expression tag' 10 10 1 2H80 LEU A 11 ? UNP Q9Y3M8 ? ? 'expression tag' 11 11 1 2H80 VAL A 12 ? UNP Q9Y3M8 ? ? 'expression tag' 12 12 1 2H80 PRO A 13 ? UNP Q9Y3M8 ? ? 'expression tag' 13 13 1 2H80 ARG A 14 ? UNP Q9Y3M8 ? ? 'expression tag' 14 14 1 2H80 GLY A 15 ? UNP Q9Y3M8 ? ? 'expression tag' 15 15 1 2H80 SER A 16 ? UNP Q9Y3M8 ? ? 'expression tag' 16 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM 15N, 13C labelled, 20mM phosphate buffer, pH 7.1, 0.05% NaN3, 4mM DTT; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2H80 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details 'The structure was based on 1098 NOE-derived distance constraints and 104 angel constraints from Talos' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2H80 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 2H80 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2H80 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 1 'Frank Delaglio' 1 'data analysis' Sparky 3.110 'Goddard, T.D., Kneller,D.G.' 2 'structure solution' CYANA 2.1 'Gntert, P.' 3 refinement Amber 7 'Case, D.A.' 4 # _exptl.entry_id 2H80 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2H80 _struct.title 'NMR structures of SAM domain of Deleted in Liver Cancer 2 (DLC2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2H80 _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'Helical bundle, LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? ALA A 31 ? SER A 16 ALA A 31 1 ? 16 HELX_P HELX_P2 2 PHE A 33 ? LEU A 39 ? PHE A 33 LEU A 39 1 ? 7 HELX_P HELX_P3 3 ASN A 48 ? ASN A 54 ? ASN A 48 ASN A 54 1 ? 7 HELX_P HELX_P4 4 LEU A 63 ? SER A 79 ? LEU A 63 SER A 79 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2H80 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2H80 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LYS 81 81 81 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-15 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.37 120.30 3.07 0.50 N 2 15 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.81 120.30 3.51 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 6 ? ? -80.82 -74.14 2 1 SER A 8 ? ? -107.81 73.14 3 1 VAL A 12 ? ? -154.12 81.70 4 1 SER A 16 ? ? -71.54 38.10 5 1 ASP A 55 ? ? -67.95 9.93 6 1 SER A 79 ? ? 46.41 23.20 7 2 SER A 16 ? ? -67.60 1.89 8 3 SER A 16 ? ? -74.67 26.89 9 3 ASN A 48 ? ? 54.70 76.95 10 3 ASP A 55 ? ? -74.74 44.09 11 4 VAL A 12 ? ? -168.58 84.07 12 4 SER A 16 ? ? -68.34 24.08 13 4 HIS A 56 ? ? 34.15 79.52 14 4 ASP A 57 ? ? -66.34 84.41 15 5 LEU A 11 ? ? -148.95 42.47 16 5 LEU A 59 ? ? -79.11 -168.18 17 6 VAL A 12 ? ? 48.20 79.95 18 6 ASN A 48 ? ? 58.00 84.81 19 6 CYS A 68 ? ? -69.65 3.56 20 7 HIS A 3 ? ? 55.10 10.38 21 7 HIS A 6 ? ? -145.19 -42.89 22 7 VAL A 12 ? ? -153.22 83.26 23 7 SER A 16 ? ? -65.15 5.35 24 7 SER A 43 ? ? 49.89 23.56 25 7 ASN A 48 ? ? 51.16 71.78 26 7 HIS A 56 ? ? 46.14 25.17 27 7 LEU A 59 ? ? -68.62 -175.92 28 8 SER A 8 ? ? 48.22 27.79 29 8 LEU A 11 ? ? -149.09 36.62 30 8 SER A 16 ? ? -74.11 25.08 31 8 ASN A 48 ? ? 54.69 74.22 32 8 SER A 79 ? ? 57.42 12.48 33 9 HIS A 4 ? ? -78.01 -78.57 34 9 VAL A 12 ? ? -154.05 88.21 35 9 ARG A 14 ? ? -142.29 -10.44 36 9 SER A 16 ? ? -76.51 40.59 37 9 ASN A 48 ? ? 51.93 75.77 38 9 ASP A 55 ? ? -74.69 39.83 39 9 HIS A 56 ? ? -67.82 79.43 40 9 GLU A 60 ? ? -55.73 101.48 41 10 HIS A 6 ? ? -68.25 84.76 42 10 SER A 9 ? ? -144.86 20.34 43 10 LEU A 11 ? ? -144.23 52.16 44 10 SER A 16 ? ? -70.39 28.95 45 10 ASN A 48 ? ? 53.82 70.33 46 10 ASP A 57 ? ? -63.48 98.78 47 11 HIS A 3 ? ? -124.95 -65.93 48 11 VAL A 12 ? ? -157.37 88.72 49 11 SER A 16 ? ? -73.96 41.85 50 11 ASN A 48 ? ? 58.99 78.18 51 11 ASP A 55 ? ? -69.80 71.76 52 11 HIS A 56 ? ? 39.28 55.77 53 11 GLU A 60 ? ? -69.17 91.59 54 12 HIS A 4 ? ? -127.40 -52.56 55 12 HIS A 5 ? ? 45.98 25.26 56 12 HIS A 6 ? ? -103.97 66.85 57 12 VAL A 12 ? ? 41.13 78.97 58 12 ASN A 48 ? ? 62.07 84.21 59 12 HIS A 56 ? ? -74.49 32.61 60 12 ASP A 57 ? ? -76.90 -162.97 61 13 VAL A 12 ? ? 43.46 79.35 62 13 ARG A 14 ? ? -134.98 -59.59 63 13 SER A 16 ? ? -64.97 2.06 64 13 HIS A 56 ? ? -72.12 39.41 65 13 ASP A 57 ? ? -74.58 43.73 66 13 SER A 79 ? ? 34.48 69.34 67 14 VAL A 12 ? ? 34.80 72.13 68 14 SER A 16 ? ? 50.44 14.62 69 14 ASN A 48 ? ? 48.82 79.75 70 14 ASP A 55 ? ? -68.78 34.90 71 14 HIS A 56 ? ? 50.01 74.50 72 15 VAL A 12 ? ? 51.04 78.91 73 16 SER A 9 ? ? -76.26 44.63 74 16 ARG A 14 ? ? -133.42 -64.78 75 16 ASN A 48 ? ? 53.89 71.37 76 16 LEU A 59 ? ? -90.41 -75.44 77 17 VAL A 12 ? ? 47.22 74.65 78 17 ARG A 14 ? ? -100.61 -60.85 79 18 HIS A 6 ? ? -65.34 97.06 80 18 VAL A 12 ? ? 52.56 76.92 81 18 ARG A 14 ? ? -145.71 -49.99 82 18 ASN A 48 ? ? 49.02 79.13 83 18 HIS A 56 ? ? 39.40 49.77 84 19 VAL A 12 ? ? 43.72 74.33 85 19 ASN A 48 ? ? 52.71 70.27 86 19 HIS A 56 ? ? -75.39 45.17 87 19 GLU A 60 ? ? -69.37 86.02 88 20 HIS A 4 ? ? 52.75 17.51 89 20 LEU A 11 ? ? -152.15 53.26 90 20 SER A 16 ? ? -79.63 20.43 91 20 ASN A 48 ? ? 54.23 76.60 92 20 ASP A 57 ? ? -55.86 104.48 #