data_2HBP # _entry.id 2HBP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HBP pdb_00002hbp 10.2210/pdb2hbp/pdb RCSB RCSB038168 ? ? WWPDB D_1000038168 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HBP _pdbx_database_status.recvd_initial_deposition_date 2006-06-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Overduin, M.' 1 'Mahadev, R.K.' 2 # _citation.id primary _citation.title 'Structure of Sla1p homology domain 1 and interaction with the NPFxD endocytic internalization motif.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 26 _citation.page_first 1963 _citation.page_last 1971 _citation.year 2007 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17363896 _citation.pdbx_database_id_DOI 10.1038/sj.emboj.7601646 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mahadev, R.K.' 1 ? primary 'Di Pietro, S.M.' 2 ? primary 'Olson, J.M.' 3 ? primary 'Piao, H.L.' 4 ? primary 'Payne, G.S.' 5 ? primary 'Overduin, M.' 6 ? # _cell.entry_id 2HBP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HBP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoskeleton assembly control protein SLA1' _entity.formula_weight 7452.612 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN _entity_poly.pdbx_seq_one_letter_code_can GSKKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 LYS n 1 5 SER n 1 6 ARG n 1 7 LEU n 1 8 TRP n 1 9 VAL n 1 10 ASP n 1 11 ARG n 1 12 SER n 1 13 GLY n 1 14 THR n 1 15 PHE n 1 16 LYS n 1 17 VAL n 1 18 ASP n 1 19 ALA n 1 20 GLU n 1 21 PHE n 1 22 ILE n 1 23 GLY n 1 24 CYS n 1 25 ALA n 1 26 LYS n 1 27 GLY n 1 28 LYS n 1 29 ILE n 1 30 HIS n 1 31 LEU n 1 32 HIS n 1 33 LYS n 1 34 ALA n 1 35 ASN n 1 36 GLY n 1 37 VAL n 1 38 LYS n 1 39 ILE n 1 40 ALA n 1 41 VAL n 1 42 ALA n 1 43 ALA n 1 44 ASP n 1 45 LYS n 1 46 LEU n 1 47 SER n 1 48 ASN n 1 49 GLU n 1 50 ASP n 1 51 LEU n 1 52 ALA n 1 53 TYR n 1 54 VAL n 1 55 GLU n 1 56 LYS n 1 57 ILE n 1 58 THR n 1 59 GLY n 1 60 PHE n 1 61 SER n 1 62 LEU n 1 63 GLU n 1 64 LYS n 1 65 PHE n 1 66 LYS n 1 67 ALA n 1 68 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene SLA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SLA1_YEAST _struct_ref.pdbx_db_accession P32790 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GSKKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN _struct_ref.pdbx_align_begin 495 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HBP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32790 _struct_ref_seq.db_align_beg 495 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 560 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HBP GLY A 1 ? UNP P32790 ? ? 'cloning artifact' 1 1 1 2HBP SER A 2 ? UNP P32790 ? ? 'cloning artifact' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 '3D-15N/13C-EDITED NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.5mM 15N, 13C labelled SHD1, 1mM unlabeled YNENPFSDPIK peptide. PBS buffer pH 6.7, 1mM d-DTT, 1mM NaN3 ; _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D20' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2HBP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2HBP _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HBP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe ? ? 1 processing Sparky ? ? 2 refinement CNS ? ? 3 # _exptl.entry_id 2HBP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2HBP _struct.title 'Solution Structure of Sla1 Homology Domain 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HBP _struct_keywords.pdbx_keywords 'ENDOCYTOSIS, PROTEIN BINDING' _struct_keywords.text 'Sla1, SHD1, NPFx(1, 2)D, endocytosis, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 47 ? GLY A 59 ? SER A 47 GLY A 59 1 ? 13 HELX_P HELX_P2 2 LEU A 62 ? LYS A 66 ? LEU A 62 LYS A 66 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 6 ? VAL A 9 ? ARG A 6 VAL A 9 A 2 LYS A 16 ? ALA A 25 ? LYS A 16 ALA A 25 A 3 LYS A 28 ? HIS A 32 ? LYS A 28 HIS A 32 A 4 LYS A 38 ? ALA A 42 ? LYS A 38 ALA A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 8 ? N TRP A 8 O VAL A 17 ? O VAL A 17 A 2 3 N GLY A 23 ? N GLY A 23 O HIS A 30 ? O HIS A 30 A 3 4 N ILE A 29 ? N ILE A 29 O VAL A 41 ? O VAL A 41 # _database_PDB_matrix.entry_id 2HBP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HBP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASN 68 68 68 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-10 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 63 ? ? HZ1 A LYS 66 ? ? 1.58 2 3 HG A CYS 24 ? ? HG12 A ILE 29 ? ? 1.31 3 3 HD11 A ILE 22 ? ? HE3 A LYS 38 ? ? 1.33 4 4 H A SER 5 ? ? HG2 A GLU 20 ? ? 1.12 5 5 HD2 A PHE 21 ? ? HG23 A ILE 29 ? ? 1.33 6 6 HD2 A PHE 21 ? ? HG21 A ILE 29 ? ? 1.32 7 6 OD2 A ASP 10 ? ? HG A SER 12 ? ? 1.59 8 7 HD1 A PHE 21 ? ? HG23 A ILE 29 ? ? 1.24 9 7 OE2 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.60 10 9 OE2 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.59 11 10 HB3 A ALA 19 ? ? HB3 A LEU 31 ? ? 1.35 12 10 HZ3 A LYS 3 ? ? OE1 A GLU 20 ? ? 1.56 13 11 HD1 A PHE 21 ? ? HG21 A ILE 29 ? ? 1.21 14 11 OE1 A GLU 63 ? ? HZ1 A LYS 66 ? ? 1.55 15 12 H A SER 5 ? ? HG2 A GLU 20 ? ? 1.20 16 12 OD1 A ASP 10 ? ? H A PHE 15 ? ? 1.60 17 13 HB3 A GLU 55 ? ? HG A LEU 62 ? ? 1.27 18 13 H A ILE 29 ? ? O A VAL 41 ? ? 1.59 19 14 OE1 A GLU 55 ? ? HZ2 A LYS 66 ? ? 1.54 20 15 OE2 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.56 21 16 HA A GLU 63 ? ? HG3 A LYS 66 ? ? 1.27 22 18 OE2 A GLU 63 ? ? HZ3 A LYS 66 ? ? 1.59 23 18 OD1 A ASP 10 ? ? H A PHE 15 ? ? 1.60 24 19 OE2 A GLU 55 ? ? HZ2 A LYS 66 ? ? 1.60 25 20 HD1 A PHE 21 ? ? HG21 A ILE 29 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 ALA A 67 ? ? -96.77 54.43 2 4 SER A 5 ? ? 54.41 105.88 3 4 LEU A 62 ? ? -102.89 41.19 4 6 SER A 5 ? ? 69.75 160.12 5 6 ALA A 67 ? ? 67.00 86.22 6 7 SER A 5 ? ? 67.91 156.54 7 7 LYS A 26 ? ? 65.67 -76.29 8 8 LYS A 4 ? ? 69.46 158.42 9 8 SER A 5 ? ? 63.13 112.11 10 10 LYS A 26 ? ? 62.68 -78.98 11 10 PHE A 60 ? ? -104.83 -166.19 12 11 SER A 5 ? ? 51.51 97.33 13 12 SER A 5 ? ? 59.58 99.79 14 12 ALA A 67 ? ? -64.44 99.91 15 13 LYS A 4 ? ? 66.35 107.63 16 15 LYS A 4 ? ? -172.73 -176.07 17 17 LYS A 4 ? ? -89.67 -143.64 18 18 ALA A 67 ? ? -77.77 -84.59 19 19 SER A 5 ? ? 71.80 125.73 20 19 LEU A 62 ? ? -97.84 35.75 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 2 Y 1 A GLY 1 ? A GLY 1 4 2 Y 1 A SER 2 ? A SER 2 5 3 Y 1 A GLY 1 ? A GLY 1 6 3 Y 1 A SER 2 ? A SER 2 7 4 Y 1 A GLY 1 ? A GLY 1 8 4 Y 1 A SER 2 ? A SER 2 9 5 Y 1 A GLY 1 ? A GLY 1 10 5 Y 1 A SER 2 ? A SER 2 11 6 Y 1 A GLY 1 ? A GLY 1 12 6 Y 1 A SER 2 ? A SER 2 13 7 Y 1 A GLY 1 ? A GLY 1 14 7 Y 1 A SER 2 ? A SER 2 15 8 Y 1 A GLY 1 ? A GLY 1 16 8 Y 1 A SER 2 ? A SER 2 17 9 Y 1 A GLY 1 ? A GLY 1 18 9 Y 1 A SER 2 ? A SER 2 19 10 Y 1 A GLY 1 ? A GLY 1 20 10 Y 1 A SER 2 ? A SER 2 21 11 Y 1 A GLY 1 ? A GLY 1 22 11 Y 1 A SER 2 ? A SER 2 23 12 Y 1 A GLY 1 ? A GLY 1 24 12 Y 1 A SER 2 ? A SER 2 25 13 Y 1 A GLY 1 ? A GLY 1 26 13 Y 1 A SER 2 ? A SER 2 27 14 Y 1 A GLY 1 ? A GLY 1 28 14 Y 1 A SER 2 ? A SER 2 29 15 Y 1 A GLY 1 ? A GLY 1 30 15 Y 1 A SER 2 ? A SER 2 31 16 Y 1 A GLY 1 ? A GLY 1 32 16 Y 1 A SER 2 ? A SER 2 33 17 Y 1 A GLY 1 ? A GLY 1 34 17 Y 1 A SER 2 ? A SER 2 35 18 Y 1 A GLY 1 ? A GLY 1 36 18 Y 1 A SER 2 ? A SER 2 37 19 Y 1 A GLY 1 ? A GLY 1 38 19 Y 1 A SER 2 ? A SER 2 39 20 Y 1 A GLY 1 ? A GLY 1 40 20 Y 1 A SER 2 ? A SER 2 #