data_2HFI # _entry.id 2HFI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HFI pdb_00002hfi 10.2210/pdb2hfi/pdb RCSB RCSB038289 ? ? WWPDB D_1000038289 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HFI _pdbx_database_status.recvd_initial_deposition_date 2006-06-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SR213 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Singarapu, K.K.' 2 'Parish, D.' 3 'Eletsky, A.' 4 'Xu, D.' 5 'Sukumaran, D.' 6 'Ho, C.K.' 7 'Fang, Y.' 8 'Cunningham, K.' 9 'Ma, L.-C.' 10 'Xiao, R.' 11 'Liu, J.' 12 'Baran, M.' 13 'Swapna, G.V.T.' 14 'Acton, T.B.' 15 'Rost, B.' 16 'Montelione, G.T.' 17 'Szyperski, T.' 18 'Northeast Structural Genomics Consortium (NESG)' 19 # _citation.id primary _citation.title 'Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Singarapu, K.K.' 2 ? primary 'Parish, D.' 3 ? primary 'Eletsky, A.' 4 ? primary 'Sukumaran, D.K.' 5 ? primary 'Xu, D.' 6 ? primary 'Ho, C.K.' 7 ? primary 'Fang, Y.' 8 ? primary 'Cunningham, K.' 9 ? primary 'Ma, L.-C.' 10 ? primary 'Xiao, R.' 11 ? primary 'Liu, J.' 12 ? primary 'Baran, M.' 13 ? primary 'Swapna, G.V.T.' 14 ? primary 'Acton, T.B.' 15 ? primary 'Rost, B.' 16 ? primary 'Montelione, G.T.' 17 ? primary 'Szyperski, T.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein yppE' _entity.formula_weight 15554.519 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKD NFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKD NFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSRLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SR213 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 SER n 1 4 GLN n 1 5 THR n 1 6 LEU n 1 7 LEU n 1 8 GLU n 1 9 MET n 1 10 THR n 1 11 GLU n 1 12 GLN n 1 13 MET n 1 14 ILE n 1 15 GLU n 1 16 VAL n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 GLY n 1 21 ALA n 1 22 ASP n 1 23 ARG n 1 24 TYR n 1 25 GLN n 1 26 GLU n 1 27 GLY n 1 28 LYS n 1 29 ASN n 1 30 SER n 1 31 ASN n 1 32 HIS n 1 33 SER n 1 34 TYR n 1 35 ASP n 1 36 PHE n 1 37 PHE n 1 38 GLU n 1 39 THR n 1 40 ILE n 1 41 LYS n 1 42 PRO n 1 43 ALA n 1 44 VAL n 1 45 GLU n 1 46 GLU n 1 47 ASN n 1 48 ASP n 1 49 GLU n 1 50 LEU n 1 51 ALA n 1 52 ALA n 1 53 ARG n 1 54 TRP n 1 55 ALA n 1 56 GLU n 1 57 GLY n 1 58 ALA n 1 59 LEU n 1 60 GLU n 1 61 LEU n 1 62 ILE n 1 63 LYS n 1 64 VAL n 1 65 ARG n 1 66 ARG n 1 67 PRO n 1 68 LYS n 1 69 TYR n 1 70 VAL n 1 71 HIS n 1 72 LYS n 1 73 GLU n 1 74 GLN n 1 75 ILE n 1 76 GLU n 1 77 ALA n 1 78 VAL n 1 79 LYS n 1 80 ASP n 1 81 ASN n 1 82 PHE n 1 83 LEU n 1 84 GLU n 1 85 LEU n 1 86 VAL n 1 87 LEU n 1 88 GLN n 1 89 SER n 1 90 TYR n 1 91 VAL n 1 92 HIS n 1 93 HIS n 1 94 ILE n 1 95 HIS n 1 96 LYS n 1 97 LYS n 1 98 ARG n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 ILE n 1 103 THR n 1 104 GLU n 1 105 SER n 1 106 VAL n 1 107 LEU n 1 108 TYR n 1 109 THR n 1 110 LEU n 1 111 HIS n 1 112 ALA n 1 113 VAL n 1 114 LYS n 1 115 ASP n 1 116 GLU n 1 117 ILE n 1 118 ALA n 1 119 ARG n 1 120 GLU n 1 121 ASP n 1 122 SER n 1 123 ARG n 1 124 LEU n 1 125 GLU n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n 1 131 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene yppE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BC21(DE3)+magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name sr213-21.2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LEU 124 124 ? ? ? A . n A 1 125 GLU 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 HIS 131 131 ? ? ? A . n # _exptl.entry_id 2HFI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2HFI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2HFI _struct.title 'Solution NMR Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HFI _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;YPPE_BACSU, GFT NMR, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YPPE_BACSU _struct_ref.pdbx_db_accession P50833 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HFI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P50833 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HFI LEU A 124 ? UNP P50833 ? ? 'cloning artifact' 124 1 1 2HFI GLU A 125 ? UNP P50833 ? ? 'cloning artifact' 125 2 1 2HFI HIS A 126 ? UNP P50833 ? ? 'expression tag' 126 3 1 2HFI HIS A 127 ? UNP P50833 ? ? 'expression tag' 127 4 1 2HFI HIS A 128 ? UNP P50833 ? ? 'expression tag' 128 5 1 2HFI HIS A 129 ? UNP P50833 ? ? 'expression tag' 129 6 1 2HFI HIS A 130 ? UNP P50833 ? ? 'expression tag' 130 7 1 2HFI HIS A 131 ? UNP P50833 ? ? 'expression tag' 131 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 4 ? GLY A 27 ? GLN A 4 GLY A 27 1 ? 24 HELX_P HELX_P2 2 THR A 39 ? ARG A 65 ? THR A 39 ARG A 65 1 ? 27 HELX_P HELX_P3 3 HIS A 71 ? HIS A 92 ? HIS A 71 HIS A 92 1 ? 22 HELX_P HELX_P4 4 LYS A 96 ? ASP A 121 ? LYS A 96 ASP A 121 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OE1 A GLU 18 ? ? HZ3 A LYS 19 ? ? 1.57 2 5 OE2 A GLU 84 ? ? HE2 A HIS 93 ? ? 1.56 3 6 OE2 A GLU 11 ? ? HZ3 A LYS 114 ? ? 1.55 4 6 OD2 A ASP 115 ? ? HH21 A ARG 119 ? ? 1.59 5 6 OD1 A ASP 35 ? ? H A GLU 38 ? ? 1.60 6 8 OE1 A GLU 15 ? ? HZ1 A LYS 19 ? ? 1.59 7 9 HZ1 A LYS 72 ? ? OE1 A GLU 76 ? ? 1.55 8 9 HZ2 A LYS 68 ? ? OE1 A GLU 120 ? ? 1.59 9 10 OE1 A GLU 60 ? ? HZ2 A LYS 63 ? ? 1.59 10 11 H A LYS 68 ? ? OE1 A GLU 116 ? ? 1.59 11 13 HZ1 A LYS 68 ? ? OE1 A GLU 120 ? ? 1.54 12 15 HZ2 A LYS 72 ? ? OE2 A GLU 76 ? ? 1.57 13 15 OE2 A GLU 11 ? ? HZ3 A LYS 114 ? ? 1.59 14 18 HH21 A ARG 98 ? ? OD2 A ASP 101 ? ? 1.58 15 20 HZ3 A LYS 68 ? ? OE1 A GLU 116 ? ? 1.56 16 20 OE1 A GLU 15 ? ? HZ1 A LYS 19 ? ? 1.59 17 20 HZ3 A LYS 72 ? ? OE1 A GLU 76 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 28 ? ? 169.81 -34.18 2 1 PHE A 37 ? ? -173.33 -52.79 3 1 GLU A 38 ? ? -64.18 -73.76 4 1 ARG A 65 ? ? -87.27 -106.14 5 1 ARG A 66 ? ? 172.91 123.69 6 1 HIS A 95 ? ? -87.28 -76.96 7 1 LYS A 96 ? ? -153.76 -76.07 8 1 ASP A 121 ? ? 73.04 123.98 9 2 THR A 5 ? ? 62.34 -98.52 10 2 ASN A 29 ? ? 65.61 -78.96 11 2 SER A 33 ? ? 63.33 94.29 12 2 LYS A 68 ? ? -93.78 -64.57 13 2 ASP A 121 ? ? 72.36 135.81 14 2 SER A 122 ? ? -164.13 98.70 15 3 GLN A 4 ? ? 56.93 80.04 16 3 ASN A 29 ? ? -168.47 -168.30 17 3 PHE A 36 ? ? 62.78 -78.95 18 3 PHE A 37 ? ? -80.54 30.43 19 3 LYS A 41 ? ? -163.34 -60.24 20 3 ARG A 66 ? ? 71.83 137.85 21 3 ASP A 121 ? ? 61.91 68.89 22 4 SER A 3 ? ? 57.74 84.81 23 4 THR A 5 ? ? 70.57 -71.79 24 4 HIS A 32 ? ? -81.61 -79.09 25 4 LYS A 41 ? ? -164.82 -57.25 26 4 ARG A 66 ? ? 77.28 150.20 27 4 HIS A 95 ? ? -129.08 -67.15 28 4 LYS A 96 ? ? -166.88 -57.94 29 4 ASP A 121 ? ? 70.46 140.86 30 5 LEU A 2 ? ? 73.40 142.49 31 5 LEU A 6 ? ? 170.05 -38.93 32 5 SER A 30 ? ? 73.16 122.07 33 5 SER A 33 ? ? 73.14 -31.10 34 5 ASP A 35 ? ? -169.19 91.78 35 5 PHE A 36 ? ? 70.11 -61.57 36 5 GLU A 38 ? ? 71.17 -40.18 37 5 THR A 39 ? ? -98.86 -63.90 38 5 LYS A 41 ? ? -147.26 -66.53 39 5 ARG A 65 ? ? -114.94 -166.33 40 5 HIS A 93 ? ? -82.62 35.15 41 5 HIS A 95 ? ? 61.51 -76.89 42 5 LYS A 96 ? ? -162.14 -54.87 43 6 ASN A 31 ? ? 60.97 85.11 44 6 SER A 33 ? ? 70.61 141.31 45 6 TYR A 34 ? ? -160.64 -55.73 46 6 PHE A 37 ? ? -141.25 -20.22 47 6 ARG A 65 ? ? -106.42 -80.32 48 6 ARG A 66 ? ? -175.44 141.33 49 6 TYR A 69 ? ? 67.16 -70.08 50 7 LEU A 2 ? ? -162.03 112.15 51 7 SER A 3 ? ? -76.87 37.90 52 7 THR A 5 ? ? 173.44 161.11 53 7 LEU A 6 ? ? 70.35 -67.34 54 7 LYS A 41 ? ? -148.22 -60.93 55 7 ARG A 65 ? ? -106.89 -99.44 56 7 ARG A 66 ? ? 176.47 132.51 57 7 HIS A 95 ? ? -88.34 46.03 58 7 LYS A 96 ? ? 69.91 -65.76 59 8 THR A 5 ? ? 63.04 -92.34 60 8 ASN A 31 ? ? 66.44 -174.89 61 8 HIS A 32 ? ? -106.54 51.40 62 8 PHE A 36 ? ? 56.36 -84.48 63 8 GLU A 38 ? ? -76.76 -83.18 64 8 LYS A 41 ? ? -144.59 -66.20 65 8 ASP A 121 ? ? -126.62 -81.37 66 9 ASN A 29 ? ? -132.22 -87.95 67 9 HIS A 32 ? ? -161.52 43.60 68 9 TYR A 34 ? ? -173.26 139.42 69 9 ASP A 35 ? ? -151.13 71.01 70 9 PHE A 36 ? ? 72.27 -16.39 71 9 GLU A 38 ? ? -40.46 -74.18 72 9 LYS A 41 ? ? -106.52 -66.82 73 9 ARG A 65 ? ? -100.53 -99.83 74 9 HIS A 95 ? ? -80.64 -70.38 75 9 LYS A 96 ? ? -162.60 -60.54 76 9 SER A 122 ? ? -154.66 9.55 77 10 THR A 5 ? ? -62.04 90.21 78 10 LEU A 6 ? ? 170.54 -36.38 79 10 ASN A 29 ? ? -80.55 35.52 80 10 SER A 33 ? ? 74.99 -172.78 81 10 LYS A 41 ? ? -166.81 -62.08 82 10 HIS A 92 ? ? 57.27 89.93 83 10 HIS A 95 ? ? -93.65 -76.55 84 10 LYS A 96 ? ? -148.97 -66.63 85 11 LEU A 2 ? ? 74.29 -177.63 86 11 GLN A 4 ? ? 56.37 -144.95 87 11 PHE A 36 ? ? 61.96 -178.18 88 11 PHE A 37 ? ? 65.28 -82.30 89 11 ILE A 40 ? ? -96.00 57.20 90 11 LYS A 41 ? ? -148.56 -60.98 91 11 TYR A 69 ? ? -126.34 -60.75 92 11 HIS A 95 ? ? -82.64 -71.98 93 11 LYS A 96 ? ? -150.67 -75.73 94 11 ASP A 121 ? ? -165.45 103.22 95 12 SER A 30 ? ? -142.48 18.06 96 12 GLU A 38 ? ? 66.57 -88.26 97 12 ARG A 65 ? ? -102.58 -163.09 98 12 LYS A 68 ? ? -70.54 -72.37 99 12 LYS A 96 ? ? 61.45 -76.53 100 12 ASP A 121 ? ? 67.39 104.52 101 13 THR A 5 ? ? 176.57 -34.71 102 13 LYS A 28 ? ? 60.83 89.53 103 13 TYR A 34 ? ? 77.85 -12.99 104 13 PHE A 36 ? ? 69.55 155.75 105 13 PHE A 37 ? ? 71.08 -57.22 106 13 GLU A 38 ? ? -64.73 -72.14 107 13 ARG A 65 ? ? -99.60 -78.83 108 13 TYR A 69 ? ? 66.32 -70.81 109 13 ASP A 121 ? ? 57.95 88.06 110 13 SER A 122 ? ? -160.99 87.98 111 14 SER A 3 ? ? -176.48 -38.82 112 14 GLN A 4 ? ? 69.14 -80.06 113 14 THR A 5 ? ? -175.58 36.42 114 14 LEU A 6 ? ? -162.47 -36.24 115 14 ASN A 31 ? ? -75.32 -84.74 116 14 HIS A 32 ? ? -163.85 70.54 117 14 ASP A 35 ? ? -75.91 -73.52 118 14 PHE A 36 ? ? -165.19 -72.10 119 14 LYS A 41 ? ? -169.52 -57.63 120 14 LYS A 68 ? ? -157.84 -29.71 121 15 LYS A 28 ? ? -115.11 51.63 122 15 SER A 33 ? ? 73.16 -49.31 123 15 ASP A 35 ? ? -152.33 57.56 124 15 PHE A 36 ? ? 61.83 -83.73 125 15 LYS A 41 ? ? -170.13 -60.80 126 15 HIS A 93 ? ? -118.85 70.30 127 15 HIS A 95 ? ? -89.04 -71.21 128 15 LYS A 96 ? ? -159.98 -71.89 129 16 ASN A 31 ? ? 69.17 112.96 130 16 ASP A 35 ? ? -175.68 -102.64 131 16 PHE A 37 ? ? 68.85 -67.60 132 16 LYS A 41 ? ? -164.49 -58.14 133 16 ARG A 65 ? ? -91.35 -88.32 134 16 ARG A 66 ? ? 175.69 155.59 135 16 TYR A 69 ? ? -129.86 -54.21 136 16 HIS A 95 ? ? -109.14 71.30 137 16 LYS A 96 ? ? -166.73 -161.85 138 16 GLU A 120 ? ? -91.09 -64.36 139 17 GLN A 4 ? ? 64.37 -172.26 140 17 TYR A 34 ? ? 67.81 -76.07 141 17 ASP A 35 ? ? 69.75 143.93 142 17 ILE A 40 ? ? -102.61 -61.11 143 17 ARG A 65 ? ? -114.45 -161.02 144 17 LYS A 68 ? ? 64.55 107.03 145 17 TYR A 69 ? ? 68.89 -68.42 146 17 HIS A 93 ? ? -89.44 39.87 147 17 HIS A 95 ? ? -134.91 -72.99 148 17 LYS A 96 ? ? -149.55 -57.33 149 18 THR A 5 ? ? -94.15 -78.42 150 18 HIS A 32 ? ? 177.45 136.61 151 18 ASP A 35 ? ? -109.13 -68.08 152 18 PHE A 37 ? ? 70.36 -163.52 153 18 GLU A 38 ? ? 64.94 -78.86 154 18 LYS A 41 ? ? 170.59 -60.79 155 18 LYS A 68 ? ? 69.87 -70.46 156 18 HIS A 92 ? ? 59.05 88.40 157 18 SER A 122 ? ? -125.63 -81.17 158 19 SER A 3 ? ? 50.21 74.61 159 19 THR A 5 ? ? -157.20 -71.19 160 19 LYS A 28 ? ? 58.38 82.34 161 19 SER A 30 ? ? -171.23 -146.12 162 19 TYR A 34 ? ? -144.10 -48.05 163 19 PHE A 37 ? ? -152.91 87.01 164 19 GLU A 38 ? ? -177.94 -76.08 165 19 LYS A 41 ? ? -144.92 -56.28 166 19 TYR A 69 ? ? 72.39 -49.05 167 19 HIS A 93 ? ? -92.81 46.43 168 19 HIS A 95 ? ? -84.92 -93.40 169 19 LYS A 96 ? ? -143.99 -80.64 170 19 ASP A 121 ? ? -178.89 -55.14 171 19 SER A 122 ? ? -174.72 -69.01 172 20 LEU A 6 ? ? -163.95 4.15 173 20 ASN A 29 ? ? 71.59 147.16 174 20 PHE A 37 ? ? -150.79 -39.30 175 20 LYS A 41 ? ? -168.27 -64.94 176 20 HIS A 92 ? ? 37.05 81.48 177 20 LYS A 96 ? ? -164.85 -43.57 178 20 ASP A 121 ? ? -173.80 103.90 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 2HFI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HFI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'Buffer: MC2023 -- 50mM Arginine, 10mM DTT, 50mM Bis Tris pH 6.5, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'SIMULTANEOUS HETERONUCLEAR RESOLVED [1H,1H]-NOESY' 1 2 1 'GFT (4,3)D HNNCABCA' 1 3 1 'GFT (4,3)D CABCA(CO)NHN' 1 4 1 'GFT (4,3) HCCH' 1 5 1 HNCACB 1 6 1 HABcoNH 1 # _pdbx_nmr_details.entry_id 2HFI _pdbx_nmr_details.text 'The protein start to form dimer at NMR concentration' # _pdbx_nmr_refine.entry_id 2HFI _pdbx_nmr_refine.method ;simulated annealing, molecular dynamics, torsion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR c VARIAN 1 processing NMRPipe 2.3 'Delaglio, F.' 2 'data analysis' XEASY 1.3.1.3 'BARTELS, C.' 3 'structure solution' CYANA 2.1 GUNTERT,P. 4 'data analysis' AutoStructure 2.0 'HUANG, Y.J.' 5 refinement CNS 1.1 'Brunger, A.T.' 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 124 ? A LEU 124 2 1 Y 1 A GLU 125 ? A GLU 125 3 1 Y 1 A HIS 126 ? A HIS 126 4 1 Y 1 A HIS 127 ? A HIS 127 5 1 Y 1 A HIS 128 ? A HIS 128 6 1 Y 1 A HIS 129 ? A HIS 129 7 1 Y 1 A HIS 130 ? A HIS 130 8 1 Y 1 A HIS 131 ? A HIS 131 9 2 Y 1 A LEU 124 ? A LEU 124 10 2 Y 1 A GLU 125 ? A GLU 125 11 2 Y 1 A HIS 126 ? A HIS 126 12 2 Y 1 A HIS 127 ? A HIS 127 13 2 Y 1 A HIS 128 ? A HIS 128 14 2 Y 1 A HIS 129 ? A HIS 129 15 2 Y 1 A HIS 130 ? A HIS 130 16 2 Y 1 A HIS 131 ? A HIS 131 17 3 Y 1 A LEU 124 ? A LEU 124 18 3 Y 1 A GLU 125 ? A GLU 125 19 3 Y 1 A HIS 126 ? A HIS 126 20 3 Y 1 A HIS 127 ? A HIS 127 21 3 Y 1 A HIS 128 ? A HIS 128 22 3 Y 1 A HIS 129 ? A HIS 129 23 3 Y 1 A HIS 130 ? A HIS 130 24 3 Y 1 A HIS 131 ? A HIS 131 25 4 Y 1 A LEU 124 ? A LEU 124 26 4 Y 1 A GLU 125 ? A GLU 125 27 4 Y 1 A HIS 126 ? A HIS 126 28 4 Y 1 A HIS 127 ? A HIS 127 29 4 Y 1 A HIS 128 ? A HIS 128 30 4 Y 1 A HIS 129 ? A HIS 129 31 4 Y 1 A HIS 130 ? A HIS 130 32 4 Y 1 A HIS 131 ? A HIS 131 33 5 Y 1 A LEU 124 ? A LEU 124 34 5 Y 1 A GLU 125 ? A GLU 125 35 5 Y 1 A HIS 126 ? A HIS 126 36 5 Y 1 A HIS 127 ? A HIS 127 37 5 Y 1 A HIS 128 ? A HIS 128 38 5 Y 1 A HIS 129 ? A HIS 129 39 5 Y 1 A HIS 130 ? A HIS 130 40 5 Y 1 A HIS 131 ? A HIS 131 41 6 Y 1 A LEU 124 ? A LEU 124 42 6 Y 1 A GLU 125 ? A GLU 125 43 6 Y 1 A HIS 126 ? A HIS 126 44 6 Y 1 A HIS 127 ? A HIS 127 45 6 Y 1 A HIS 128 ? A HIS 128 46 6 Y 1 A HIS 129 ? A HIS 129 47 6 Y 1 A HIS 130 ? A HIS 130 48 6 Y 1 A HIS 131 ? A HIS 131 49 7 Y 1 A LEU 124 ? A LEU 124 50 7 Y 1 A GLU 125 ? A GLU 125 51 7 Y 1 A HIS 126 ? A HIS 126 52 7 Y 1 A HIS 127 ? A HIS 127 53 7 Y 1 A HIS 128 ? A HIS 128 54 7 Y 1 A HIS 129 ? A HIS 129 55 7 Y 1 A HIS 130 ? A HIS 130 56 7 Y 1 A HIS 131 ? A HIS 131 57 8 Y 1 A LEU 124 ? A LEU 124 58 8 Y 1 A GLU 125 ? A GLU 125 59 8 Y 1 A HIS 126 ? A HIS 126 60 8 Y 1 A HIS 127 ? A HIS 127 61 8 Y 1 A HIS 128 ? A HIS 128 62 8 Y 1 A HIS 129 ? A HIS 129 63 8 Y 1 A HIS 130 ? A HIS 130 64 8 Y 1 A HIS 131 ? A HIS 131 65 9 Y 1 A LEU 124 ? A LEU 124 66 9 Y 1 A GLU 125 ? A GLU 125 67 9 Y 1 A HIS 126 ? A HIS 126 68 9 Y 1 A HIS 127 ? A HIS 127 69 9 Y 1 A HIS 128 ? A HIS 128 70 9 Y 1 A HIS 129 ? A HIS 129 71 9 Y 1 A HIS 130 ? A HIS 130 72 9 Y 1 A HIS 131 ? A HIS 131 73 10 Y 1 A LEU 124 ? A LEU 124 74 10 Y 1 A GLU 125 ? A GLU 125 75 10 Y 1 A HIS 126 ? A HIS 126 76 10 Y 1 A HIS 127 ? A HIS 127 77 10 Y 1 A HIS 128 ? A HIS 128 78 10 Y 1 A HIS 129 ? A HIS 129 79 10 Y 1 A HIS 130 ? A HIS 130 80 10 Y 1 A HIS 131 ? A HIS 131 81 11 Y 1 A LEU 124 ? A LEU 124 82 11 Y 1 A GLU 125 ? A GLU 125 83 11 Y 1 A HIS 126 ? A HIS 126 84 11 Y 1 A HIS 127 ? A HIS 127 85 11 Y 1 A HIS 128 ? A HIS 128 86 11 Y 1 A HIS 129 ? A HIS 129 87 11 Y 1 A HIS 130 ? A HIS 130 88 11 Y 1 A HIS 131 ? A HIS 131 89 12 Y 1 A LEU 124 ? A LEU 124 90 12 Y 1 A GLU 125 ? A GLU 125 91 12 Y 1 A HIS 126 ? A HIS 126 92 12 Y 1 A HIS 127 ? A HIS 127 93 12 Y 1 A HIS 128 ? A HIS 128 94 12 Y 1 A HIS 129 ? A HIS 129 95 12 Y 1 A HIS 130 ? A HIS 130 96 12 Y 1 A HIS 131 ? A HIS 131 97 13 Y 1 A LEU 124 ? A LEU 124 98 13 Y 1 A GLU 125 ? A GLU 125 99 13 Y 1 A HIS 126 ? A HIS 126 100 13 Y 1 A HIS 127 ? A HIS 127 101 13 Y 1 A HIS 128 ? A HIS 128 102 13 Y 1 A HIS 129 ? A HIS 129 103 13 Y 1 A HIS 130 ? A HIS 130 104 13 Y 1 A HIS 131 ? A HIS 131 105 14 Y 1 A LEU 124 ? A LEU 124 106 14 Y 1 A GLU 125 ? A GLU 125 107 14 Y 1 A HIS 126 ? A HIS 126 108 14 Y 1 A HIS 127 ? A HIS 127 109 14 Y 1 A HIS 128 ? A HIS 128 110 14 Y 1 A HIS 129 ? A HIS 129 111 14 Y 1 A HIS 130 ? A HIS 130 112 14 Y 1 A HIS 131 ? A HIS 131 113 15 Y 1 A LEU 124 ? A LEU 124 114 15 Y 1 A GLU 125 ? A GLU 125 115 15 Y 1 A HIS 126 ? A HIS 126 116 15 Y 1 A HIS 127 ? A HIS 127 117 15 Y 1 A HIS 128 ? A HIS 128 118 15 Y 1 A HIS 129 ? A HIS 129 119 15 Y 1 A HIS 130 ? A HIS 130 120 15 Y 1 A HIS 131 ? A HIS 131 121 16 Y 1 A LEU 124 ? A LEU 124 122 16 Y 1 A GLU 125 ? A GLU 125 123 16 Y 1 A HIS 126 ? A HIS 126 124 16 Y 1 A HIS 127 ? A HIS 127 125 16 Y 1 A HIS 128 ? A HIS 128 126 16 Y 1 A HIS 129 ? A HIS 129 127 16 Y 1 A HIS 130 ? A HIS 130 128 16 Y 1 A HIS 131 ? A HIS 131 129 17 Y 1 A LEU 124 ? A LEU 124 130 17 Y 1 A GLU 125 ? A GLU 125 131 17 Y 1 A HIS 126 ? A HIS 126 132 17 Y 1 A HIS 127 ? A HIS 127 133 17 Y 1 A HIS 128 ? A HIS 128 134 17 Y 1 A HIS 129 ? A HIS 129 135 17 Y 1 A HIS 130 ? A HIS 130 136 17 Y 1 A HIS 131 ? A HIS 131 137 18 Y 1 A LEU 124 ? A LEU 124 138 18 Y 1 A GLU 125 ? A GLU 125 139 18 Y 1 A HIS 126 ? A HIS 126 140 18 Y 1 A HIS 127 ? A HIS 127 141 18 Y 1 A HIS 128 ? A HIS 128 142 18 Y 1 A HIS 129 ? A HIS 129 143 18 Y 1 A HIS 130 ? A HIS 130 144 18 Y 1 A HIS 131 ? A HIS 131 145 19 Y 1 A LEU 124 ? A LEU 124 146 19 Y 1 A GLU 125 ? A GLU 125 147 19 Y 1 A HIS 126 ? A HIS 126 148 19 Y 1 A HIS 127 ? A HIS 127 149 19 Y 1 A HIS 128 ? A HIS 128 150 19 Y 1 A HIS 129 ? A HIS 129 151 19 Y 1 A HIS 130 ? A HIS 130 152 19 Y 1 A HIS 131 ? A HIS 131 153 20 Y 1 A LEU 124 ? A LEU 124 154 20 Y 1 A GLU 125 ? A GLU 125 155 20 Y 1 A HIS 126 ? A HIS 126 156 20 Y 1 A HIS 127 ? A HIS 127 157 20 Y 1 A HIS 128 ? A HIS 128 158 20 Y 1 A HIS 129 ? A HIS 129 159 20 Y 1 A HIS 130 ? A HIS 130 160 20 Y 1 A HIS 131 ? A HIS 131 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 750 ? 2 INOVA Varian 600 ? 3 AVANCE Bruker 800 ? # _atom_sites.entry_id 2HFI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_