data_2HI5 # _entry.id 2HI5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HI5 pdb_00002hi5 10.2210/pdb2hi5/pdb RCSB RCSB038373 ? ? WWPDB D_1000038373 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-07-18 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 1 4 2024-02-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' Advisory 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' em_image_scans 2 3 'Structure model' em_single_particle_entity 3 3 'Structure model' em_software 4 4 'Structure model' atom_sites 5 4 'Structure model' cell 6 4 'Structure model' pdbx_validate_symm_contact 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_em_software.image_processing_id' 2 4 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 3 4 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 4 4 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 5 4 'Structure model' '_cell.angle_alpha' 6 4 'Structure model' '_cell.length_a' 7 4 'Structure model' '_cell.length_b' 8 4 'Structure model' '_cell.length_c' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' 11 5 'Structure model' '_pdbx_struct_oper_list.name' 12 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 13 5 'Structure model' '_pdbx_struct_oper_list.type' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HI5 _pdbx_database_status.recvd_initial_deposition_date 2006-06-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.db_id EMD-1240 _pdbx_database_related.details . _pdbx_database_related.content_type 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Y.A.' 1 'Yu, X.' 2 'Overman, S.' 3 'Tsuboi, M.' 4 'Thomas, G.J.' 5 'Egelman, E.H.' 6 # _citation.id primary _citation.title 'The Structure of a Filamentous Bacteriophage' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 361 _citation.page_first 209 _citation.page_last 215 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16843489 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.06.027 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.A.' 1 ? primary 'Yu, X.' 2 ? primary 'Overman, S.' 3 ? primary 'Tsuboi, M.' 4 ? primary 'Thomas, G.J.' 5 ? primary 'Egelman, E.H.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Coat protein B' _entity.formula_weight 5244.000 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Major coat protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _entity_poly.pdbx_seq_one_letter_code_can AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLY n 1 4 ASP n 1 5 ASP n 1 6 PRO n 1 7 ALA n 1 8 LYS n 1 9 ALA n 1 10 ALA n 1 11 PHE n 1 12 ASP n 1 13 SER n 1 14 LEU n 1 15 GLN n 1 16 ALA n 1 17 SER n 1 18 ALA n 1 19 THR n 1 20 GLU n 1 21 TYR n 1 22 ILE n 1 23 GLY n 1 24 TYR n 1 25 ALA n 1 26 TRP n 1 27 ALA n 1 28 MET n 1 29 VAL n 1 30 VAL n 1 31 VAL n 1 32 ILE n 1 33 VAL n 1 34 GLY n 1 35 ALA n 1 36 THR n 1 37 ILE n 1 38 GLY n 1 39 ILE n 1 40 LYS n 1 41 LEU n 1 42 PHE n 1 43 LYS n 1 44 LYS n 1 45 PHE n 1 46 THR n 1 47 SER n 1 48 LYS n 1 49 ALA n 1 50 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Inovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage M13' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage fd' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10864 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LYS 48 48 ? ? ? A . n A 1 49 ALA 49 49 ? ? ? A . n A 1 50 SER 50 50 ? ? ? A . n # _cell.entry_id 2HI5 _cell.length_a 1.0 _cell.length_b 1.0 _cell.length_c 1.0 _cell.angle_alpha 90.0 _cell.angle_beta 90.0 _cell.angle_gamma 90.0 _cell.pdbx_unique_axis ? _cell.Z_PDB 1 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2HI5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 1 _symmetry.cell_setting ? # _exptl.entry_id 2HI5 _exptl.method 'ELECTRON MICROSCOPY' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 315 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 315 _refine_hist.d_res_high . _refine_hist.d_res_low . # _database_PDB_matrix.entry_id 2HI5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2HI5 _struct.title 'Model for bacteriophage fd from cryo-EM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HI5 _struct_keywords.pdbx_keywords VIRUS _struct_keywords.text 'helix, helical VIRUS, structural protein, DNA binding protein, VIRUS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COATB_BPFD _struct_ref.pdbx_db_accession P69539 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HI5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69539 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'representative helical assembly' ? helical 55 2 'helical asymmetric unit' ? monomeric 1 3 'helical asymmetric unit, std helical frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-55)' A 2 26 A 3 H A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] H 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'helical symmetry operation' ? ? -0.99271535 -0.12048337 0.00000000 0.00000 0.12048337 -0.99271535 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -87.00000 2 'helical symmetry operation' ? ? -0.42135241 0.90689699 0.00000000 0.00000 -0.90689699 -0.42135241 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -87.00000 3 'helical symmetry operation' ? ? 0.73230524 0.68097653 0.00000000 0.00000 -0.68097653 0.73230524 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -87.00000 4 'helical symmetry operation' ? ? 0.87394193 -0.48603035 0.00000000 0.00000 0.48603035 0.87394193 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -87.00000 5 'helical symmetry operation' ? ? -0.19217942 -0.98135981 0.00000000 0.00000 0.98135981 -0.19217942 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -87.00000 6 'helical symmetry operation' ? ? -0.74853924 -0.66309050 0.00000000 0.00000 0.66309050 -0.74853924 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.60000 7 'helical symmetry operation' ? ? -0.86194789 0.50699689 0.00000000 0.00000 -0.50699689 -0.86194789 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.60000 8 'helical symmetry operation' ? ? 0.21582615 0.97643181 0.00000000 0.00000 -0.97643181 0.21582615 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.60000 9 'helical symmetry operation' ? ? 0.99533578 0.09647116 0.00000000 0.00000 -0.09647116 0.99533578 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.60000 10 'helical symmetry operation' ? ? 0.39932520 -0.91680935 0.00000000 0.00000 0.91680935 0.39932520 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.60000 11 'helical symmetry operation' ? ? -0.23934695 -0.97093411 0.00000000 0.00000 0.97093411 -0.23934695 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.20000 12 'helical symmetry operation' ? ? -0.99737548 -0.07240266 0.00000000 0.00000 0.07240266 -0.99737548 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.20000 13 'helical symmetry operation' ? ? -0.37706500 0.92618680 0.00000000 0.00000 -0.92618680 -0.37706500 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.20000 14 'helical symmetry operation' ? ? 0.76433650 0.64481759 0.00000000 0.00000 -0.64481759 0.76433650 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.20000 15 'helical symmetry operation' ? ? 0.84945093 -0.52766761 0.00000000 0.00000 0.52766761 0.84945093 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.20000 16 'helical symmetry operation' ? ? 0.35458480 -0.93502386 0.00000000 0.00000 0.93502386 0.35458480 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 17 'helical symmetry operation' ? ? -0.77968780 -0.62616845 0.00000000 0.00000 0.62616845 -0.77968780 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 18 'helical symmetry operation' ? ? -0.83645837 0.54803048 0.00000000 0.00000 -0.54803048 -0.83645837 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 19 'helical symmetry operation' ? ? 0.26272810 0.96486991 0.00000000 0.00000 -0.96486991 0.26272810 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 20 'helical symmetry operation' ? ? 0.99883326 0.04829192 0.00000000 0.00000 -0.04829192 0.99883326 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 21 'helical symmetry operation' ? ? 0.82297776 -0.56807359 0.00000000 0.00000 0.56807359 0.82297776 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 22 'helical symmetry operation' ? ? -0.28595597 -0.95824276 0.00000000 0.00000 0.95824276 -0.28595597 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 23 'helical symmetry operation' ? ? -0.99970827 -0.02415301 0.00000000 0.00000 0.02415301 -0.99970827 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 24 'helical symmetry operation' ? ? -0.33189772 0.94331538 0.00000000 0.00000 -0.94331538 -0.33189772 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 25 'helical symmetry operation' ? ? 0.79458420 0.60715397 0.00000000 0.00000 -0.60715397 0.79458420 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 26 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 27 'helical symmetry operation' ? ? 0.30901699 -0.95105652 0.00000000 0.00000 0.95105652 0.30901699 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 28 'helical symmetry operation' ? ? -0.80901699 -0.58778525 0.00000000 0.00000 0.58778525 -0.80901699 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 29 'helical symmetry operation' ? ? -0.80901699 0.58778525 0.00000000 0.00000 -0.58778525 -0.80901699 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 30 'helical symmetry operation' ? ? 0.30901699 0.95105652 0.00000000 0.00000 -0.95105652 0.30901699 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 31 'helical symmetry operation' ? ? 0.82297776 0.56807359 0.00000000 0.00000 -0.56807359 0.82297776 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 32 'helical symmetry operation' ? ? 0.79458420 -0.60715397 0.00000000 0.00000 0.60715397 0.79458420 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 33 'helical symmetry operation' ? ? -0.33189772 -0.94331538 0.00000000 0.00000 0.94331538 -0.33189772 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 34 'helical symmetry operation' ? ? -0.99970827 0.02415301 0.00000000 0.00000 -0.02415301 -0.99970827 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 35 'helical symmetry operation' ? ? -0.28595597 0.95824276 0.00000000 0.00000 -0.95824276 -0.28595597 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 36 'helical symmetry operation' ? ? 0.35458480 0.93502386 0.00000000 0.00000 -0.93502386 0.35458480 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 37 'helical symmetry operation' ? ? 0.99883326 -0.04829192 0.00000000 0.00000 0.04829192 0.99883326 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 38 'helical symmetry operation' ? ? 0.26272810 -0.96486991 0.00000000 0.00000 0.96486991 0.26272810 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 39 'helical symmetry operation' ? ? -0.83645837 -0.54803048 0.00000000 0.00000 0.54803048 -0.83645837 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 40 'helical symmetry operation' ? ? -0.77968780 0.62616845 0.00000000 0.00000 -0.62616845 -0.77968780 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 41 'helical symmetry operation' ? ? -0.23934695 0.97093411 0.00000000 0.00000 -0.97093411 -0.23934695 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.20000 42 'helical symmetry operation' ? ? 0.84945093 0.52766761 0.00000000 0.00000 -0.52766761 0.84945093 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.20000 43 'helical symmetry operation' ? ? 0.76433650 -0.64481759 0.00000000 0.00000 0.64481759 0.76433650 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.20000 44 'helical symmetry operation' ? ? -0.37706500 -0.92618680 0.00000000 0.00000 0.92618680 -0.37706500 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.20000 45 'helical symmetry operation' ? ? -0.99737548 0.07240266 0.00000000 0.00000 -0.07240266 -0.99737548 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.20000 46 'helical symmetry operation' ? ? -0.74853924 0.66309050 0.00000000 0.00000 -0.66309050 -0.74853924 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.60000 47 'helical symmetry operation' ? ? 0.39932520 0.91680935 0.00000000 0.00000 -0.91680935 0.39932520 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.60000 48 'helical symmetry operation' ? ? 0.99533578 -0.09647116 0.00000000 0.00000 0.09647116 0.99533578 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.60000 49 'helical symmetry operation' ? ? 0.21582615 -0.97643181 0.00000000 0.00000 0.97643181 0.21582615 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.60000 50 'helical symmetry operation' ? ? -0.86194789 -0.50699689 0.00000000 0.00000 0.50699689 -0.86194789 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.60000 51 'helical symmetry operation' ? ? -0.99271535 0.12048337 0.00000000 0.00000 -0.12048337 -0.99271535 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 87.00000 52 'helical symmetry operation' ? ? -0.19217942 0.98135981 0.00000000 0.00000 -0.98135981 -0.19217942 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 87.00000 53 'helical symmetry operation' ? ? 0.87394193 0.48603035 0.00000000 0.00000 -0.48603035 0.87394193 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 87.00000 54 'helical symmetry operation' ? ? 0.73230524 -0.68097653 0.00000000 0.00000 0.68097653 0.73230524 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 87.00000 55 'helical symmetry operation' ? ? -0.42135241 -0.90689699 0.00000000 0.00000 0.90689699 -0.42135241 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 87.00000 # _struct_biol.id 1 _struct_biol.details 'helical polymer' # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 47 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 47 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 42 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 35 ? ? N A THR 36 ? ? 1.20 2 1 O A GLN 15 ? ? N A ALA 16 ? ? 1.22 3 1 O A ALA 35 ? ? CA A THR 36 ? ? 1.26 4 1 C A ALA 35 ? ? CA A THR 36 ? ? 1.43 5 1 C A ALA 25 ? ? CA A TRP 26 ? ? 1.43 6 1 O A GLN 15 ? ? CA A ALA 16 ? ? 1.43 7 1 CA A ALA 35 ? ? N A THR 36 ? ? 1.50 8 1 O A ALA 25 ? ? N A TRP 26 ? ? 1.50 9 1 O A LEU 14 ? ? N A SER 17 ? ? 1.52 10 1 CA A ALA 25 ? ? N A TRP 26 ? ? 1.54 11 1 C A GLN 15 ? ? CA A ALA 16 ? ? 1.55 12 1 O A ALA 25 ? ? CA A TRP 26 ? ? 1.57 13 1 CA A GLN 15 ? ? N A ALA 16 ? ? 1.61 14 1 O A LEU 14 ? ? CB A SER 17 ? ? 1.83 15 1 O A LEU 14 ? ? CA A SER 17 ? ? 1.90 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A GLN 15 ? ? N A ALA 16 ? ? 0.089 1.336 -1.247 0.023 Y 2 1 C A ALA 25 ? ? N A TRP 26 ? ? 0.440 1.336 -0.896 0.023 Y 3 1 NE1 A TRP 26 ? ? CE2 A TRP 26 ? ? 1.278 1.371 -0.093 0.013 N 4 1 C A ALA 35 ? ? N A THR 36 ? ? 0.124 1.336 -1.212 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLN 15 ? ? C A GLN 15 ? ? N A ALA 16 ? ? 160.82 117.20 43.62 2.20 Y 2 1 O A GLN 15 ? ? C A GLN 15 ? ? N A ALA 16 ? ? 65.48 122.70 -57.22 1.60 Y 3 1 C A GLN 15 ? ? N A ALA 16 ? ? CA A ALA 16 ? ? 166.90 121.70 45.20 2.50 Y 4 1 CA A ALA 25 ? ? C A ALA 25 ? ? N A TRP 26 ? ? 84.08 117.20 -33.12 2.20 Y 5 1 C A ALA 25 ? ? N A TRP 26 ? ? CA A TRP 26 ? ? 76.21 121.70 -45.49 2.50 Y 6 1 CA A ALA 35 ? ? C A ALA 35 ? ? N A THR 36 ? ? 77.18 117.20 -40.02 2.20 Y 7 1 O A ALA 35 ? ? C A ALA 35 ? ? N A THR 36 ? ? 60.72 122.70 -61.98 1.60 Y 8 1 C A ALA 35 ? ? N A THR 36 ? ? CA A THR 36 ? ? 69.86 121.70 -51.84 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 15 ? ? -70.42 32.93 2 1 ALA A 16 ? ? -12.24 -40.26 3 1 ALA A 25 ? ? -67.59 10.41 4 1 ALA A 35 ? ? -65.33 88.39 5 1 THR A 36 ? ? 140.91 -34.97 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 15 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ALA _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 16 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 52.15 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLN A 15 ? ? -74.17 2 1 ALA A 25 ? ? -42.01 3 1 ALA A 35 ? ? -127.97 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A GLN 15 ? ? N A ALA 16 ? ? 0.09 2 1 C A ALA 25 ? ? N A TRP 26 ? ? 0.44 3 1 C A ALA 35 ? ? N A THR 36 ? ? 0.12 # _pdbx_helical_symmetry.entry_id 2HI5 _pdbx_helical_symmetry.number_of_operations 55 _pdbx_helical_symmetry.rotation_per_n_subunits -34.616000 _pdbx_helical_symmetry.rise_per_n_subunits 17.400000 _pdbx_helical_symmetry.n_subunits_divisor 1 _pdbx_helical_symmetry.dyad_axis no _pdbx_helical_symmetry.circular_symmetry 5 # _em_3d_reconstruction.entry_id 2HI5 _em_3d_reconstruction.id 1 _em_3d_reconstruction.resolution_method 'FSC 0.5 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.num_particles 16367 _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.method IHRSR _em_3d_reconstruction.nominal_pixel_size 2.4 _em_3d_reconstruction.actual_pixel_size 2.4 _em_3d_reconstruction.resolution 8.0 _em_3d_reconstruction.magnification_calibration TMV _em_3d_reconstruction.details 'The C-N bond distance is 0.09 A between GLN15 and ALA16, 0.12 A between ALA35 and THR36 and 0.44 A between ALA25 and TRP26' _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.algorithm ? # loop_ _em_entity_assembly.id _em_entity_assembly.name _em_entity_assembly.type _em_entity_assembly.parent_id _em_entity_assembly.synonym _em_entity_assembly.details _em_entity_assembly.oligomeric_details 1 'Bacteriophage fd' VIRUS 0 ? ? ? 2 'Coat protein B' ? 1 ? 'viral capsid' ? # _em_imaging.entry_id 2HI5 _em_imaging.id 1 _em_imaging.microscope_model 'FEI TECNAI F20' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.specimen_id 1 _em_imaging.date ? _em_imaging.temperature ? _em_imaging.nominal_defocus_min 1400 _em_imaging.nominal_defocus_max 3800 _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_cs ? _em_imaging.nominal_magnification 50000 _em_imaging.calibrated_magnification ? _em_imaging.accelerating_voltage 200 _em_imaging.details ? _em_imaging.specimen_holder_type Gatan _em_imaging.specimen_holder_model ? _em_imaging.citation_id ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? # _em_vitrification.entry_id 2HI5 _em_vitrification.id 1 _em_vitrification.details ? _em_vitrification.citation_id ? _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.method 'Blot for 2 seconds before plunging' _em_vitrification.specimen_id 1 _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 2HI5 _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 _em_experiment.reconstruction_method HELICAL # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A LYS 48 ? A LYS 48 7 1 Y 1 A ALA 49 ? A ALA 49 8 1 Y 1 A SER 50 ? A SER 50 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 GLN N N N N 30 GLN CA C N S 31 GLN C C N N 32 GLN O O N N 33 GLN CB C N N 34 GLN CG C N N 35 GLN CD C N N 36 GLN OE1 O N N 37 GLN NE2 N N N 38 GLN OXT O N N 39 GLN H H N N 40 GLN H2 H N N 41 GLN HA H N N 42 GLN HB2 H N N 43 GLN HB3 H N N 44 GLN HG2 H N N 45 GLN HG3 H N N 46 GLN HE21 H N N 47 GLN HE22 H N N 48 GLN HXT H N N 49 GLU N N N N 50 GLU CA C N S 51 GLU C C N N 52 GLU O O N N 53 GLU CB C N N 54 GLU CG C N N 55 GLU CD C N N 56 GLU OE1 O N N 57 GLU OE2 O N N 58 GLU OXT O N N 59 GLU H H N N 60 GLU H2 H N N 61 GLU HA H N N 62 GLU HB2 H N N 63 GLU HB3 H N N 64 GLU HG2 H N N 65 GLU HG3 H N N 66 GLU HE2 H N N 67 GLU HXT H N N 68 GLY N N N N 69 GLY CA C N N 70 GLY C C N N 71 GLY O O N N 72 GLY OXT O N N 73 GLY H H N N 74 GLY H2 H N N 75 GLY HA2 H N N 76 GLY HA3 H N N 77 GLY HXT H N N 78 ILE N N N N 79 ILE CA C N S 80 ILE C C N N 81 ILE O O N N 82 ILE CB C N S 83 ILE CG1 C N N 84 ILE CG2 C N N 85 ILE CD1 C N N 86 ILE OXT O N N 87 ILE H H N N 88 ILE H2 H N N 89 ILE HA H N N 90 ILE HB H N N 91 ILE HG12 H N N 92 ILE HG13 H N N 93 ILE HG21 H N N 94 ILE HG22 H N N 95 ILE HG23 H N N 96 ILE HD11 H N N 97 ILE HD12 H N N 98 ILE HD13 H N N 99 ILE HXT H N N 100 LEU N N N N 101 LEU CA C N S 102 LEU C C N N 103 LEU O O N N 104 LEU CB C N N 105 LEU CG C N N 106 LEU CD1 C N N 107 LEU CD2 C N N 108 LEU OXT O N N 109 LEU H H N N 110 LEU H2 H N N 111 LEU HA H N N 112 LEU HB2 H N N 113 LEU HB3 H N N 114 LEU HG H N N 115 LEU HD11 H N N 116 LEU HD12 H N N 117 LEU HD13 H N N 118 LEU HD21 H N N 119 LEU HD22 H N N 120 LEU HD23 H N N 121 LEU HXT H N N 122 LYS N N N N 123 LYS CA C N S 124 LYS C C N N 125 LYS O O N N 126 LYS CB C N N 127 LYS CG C N N 128 LYS CD C N N 129 LYS CE C N N 130 LYS NZ N N N 131 LYS OXT O N N 132 LYS H H N N 133 LYS H2 H N N 134 LYS HA H N N 135 LYS HB2 H N N 136 LYS HB3 H N N 137 LYS HG2 H N N 138 LYS HG3 H N N 139 LYS HD2 H N N 140 LYS HD3 H N N 141 LYS HE2 H N N 142 LYS HE3 H N N 143 LYS HZ1 H N N 144 LYS HZ2 H N N 145 LYS HZ3 H N N 146 LYS HXT H N N 147 MET N N N N 148 MET CA C N S 149 MET C C N N 150 MET O O N N 151 MET CB C N N 152 MET CG C N N 153 MET SD S N N 154 MET CE C N N 155 MET OXT O N N 156 MET H H N N 157 MET H2 H N N 158 MET HA H N N 159 MET HB2 H N N 160 MET HB3 H N N 161 MET HG2 H N N 162 MET HG3 H N N 163 MET HE1 H N N 164 MET HE2 H N N 165 MET HE3 H N N 166 MET HXT H N N 167 PHE N N N N 168 PHE CA C N S 169 PHE C C N N 170 PHE O O N N 171 PHE CB C N N 172 PHE CG C Y N 173 PHE CD1 C Y N 174 PHE CD2 C Y N 175 PHE CE1 C Y N 176 PHE CE2 C Y N 177 PHE CZ C Y N 178 PHE OXT O N N 179 PHE H H N N 180 PHE H2 H N N 181 PHE HA H N N 182 PHE HB2 H N N 183 PHE HB3 H N N 184 PHE HD1 H N N 185 PHE HD2 H N N 186 PHE HE1 H N N 187 PHE HE2 H N N 188 PHE HZ H N N 189 PHE HXT H N N 190 PRO N N N N 191 PRO CA C N S 192 PRO C C N N 193 PRO O O N N 194 PRO CB C N N 195 PRO CG C N N 196 PRO CD C N N 197 PRO OXT O N N 198 PRO H H N N 199 PRO HA H N N 200 PRO HB2 H N N 201 PRO HB3 H N N 202 PRO HG2 H N N 203 PRO HG3 H N N 204 PRO HD2 H N N 205 PRO HD3 H N N 206 PRO HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 TRP N N N N 239 TRP CA C N S 240 TRP C C N N 241 TRP O O N N 242 TRP CB C N N 243 TRP CG C Y N 244 TRP CD1 C Y N 245 TRP CD2 C Y N 246 TRP NE1 N Y N 247 TRP CE2 C Y N 248 TRP CE3 C Y N 249 TRP CZ2 C Y N 250 TRP CZ3 C Y N 251 TRP CH2 C Y N 252 TRP OXT O N N 253 TRP H H N N 254 TRP H2 H N N 255 TRP HA H N N 256 TRP HB2 H N N 257 TRP HB3 H N N 258 TRP HD1 H N N 259 TRP HE1 H N N 260 TRP HE3 H N N 261 TRP HZ2 H N N 262 TRP HZ3 H N N 263 TRP HH2 H N N 264 TRP HXT H N N 265 TYR N N N N 266 TYR CA C N S 267 TYR C C N N 268 TYR O O N N 269 TYR CB C N N 270 TYR CG C Y N 271 TYR CD1 C Y N 272 TYR CD2 C Y N 273 TYR CE1 C Y N 274 TYR CE2 C Y N 275 TYR CZ C Y N 276 TYR OH O N N 277 TYR OXT O N N 278 TYR H H N N 279 TYR H2 H N N 280 TYR HA H N N 281 TYR HB2 H N N 282 TYR HB3 H N N 283 TYR HD1 H N N 284 TYR HD2 H N N 285 TYR HE1 H N N 286 TYR HE2 H N N 287 TYR HH H N N 288 TYR HXT H N N 289 VAL N N N N 290 VAL CA C N S 291 VAL C C N N 292 VAL O O N N 293 VAL CB C N N 294 VAL CG1 C N N 295 VAL CG2 C N N 296 VAL OXT O N N 297 VAL H H N N 298 VAL H2 H N N 299 VAL HA H N N 300 VAL HB H N N 301 VAL HG11 H N N 302 VAL HG12 H N N 303 VAL HG13 H N N 304 VAL HG21 H N N 305 VAL HG22 H N N 306 VAL HG23 H N N 307 VAL HXT H N N 308 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 GLN N CA sing N N 28 GLN N H sing N N 29 GLN N H2 sing N N 30 GLN CA C sing N N 31 GLN CA CB sing N N 32 GLN CA HA sing N N 33 GLN C O doub N N 34 GLN C OXT sing N N 35 GLN CB CG sing N N 36 GLN CB HB2 sing N N 37 GLN CB HB3 sing N N 38 GLN CG CD sing N N 39 GLN CG HG2 sing N N 40 GLN CG HG3 sing N N 41 GLN CD OE1 doub N N 42 GLN CD NE2 sing N N 43 GLN NE2 HE21 sing N N 44 GLN NE2 HE22 sing N N 45 GLN OXT HXT sing N N 46 GLU N CA sing N N 47 GLU N H sing N N 48 GLU N H2 sing N N 49 GLU CA C sing N N 50 GLU CA CB sing N N 51 GLU CA HA sing N N 52 GLU C O doub N N 53 GLU C OXT sing N N 54 GLU CB CG sing N N 55 GLU CB HB2 sing N N 56 GLU CB HB3 sing N N 57 GLU CG CD sing N N 58 GLU CG HG2 sing N N 59 GLU CG HG3 sing N N 60 GLU CD OE1 doub N N 61 GLU CD OE2 sing N N 62 GLU OE2 HE2 sing N N 63 GLU OXT HXT sing N N 64 GLY N CA sing N N 65 GLY N H sing N N 66 GLY N H2 sing N N 67 GLY CA C sing N N 68 GLY CA HA2 sing N N 69 GLY CA HA3 sing N N 70 GLY C O doub N N 71 GLY C OXT sing N N 72 GLY OXT HXT sing N N 73 ILE N CA sing N N 74 ILE N H sing N N 75 ILE N H2 sing N N 76 ILE CA C sing N N 77 ILE CA CB sing N N 78 ILE CA HA sing N N 79 ILE C O doub N N 80 ILE C OXT sing N N 81 ILE CB CG1 sing N N 82 ILE CB CG2 sing N N 83 ILE CB HB sing N N 84 ILE CG1 CD1 sing N N 85 ILE CG1 HG12 sing N N 86 ILE CG1 HG13 sing N N 87 ILE CG2 HG21 sing N N 88 ILE CG2 HG22 sing N N 89 ILE CG2 HG23 sing N N 90 ILE CD1 HD11 sing N N 91 ILE CD1 HD12 sing N N 92 ILE CD1 HD13 sing N N 93 ILE OXT HXT sing N N 94 LEU N CA sing N N 95 LEU N H sing N N 96 LEU N H2 sing N N 97 LEU CA C sing N N 98 LEU CA CB sing N N 99 LEU CA HA sing N N 100 LEU C O doub N N 101 LEU C OXT sing N N 102 LEU CB CG sing N N 103 LEU CB HB2 sing N N 104 LEU CB HB3 sing N N 105 LEU CG CD1 sing N N 106 LEU CG CD2 sing N N 107 LEU CG HG sing N N 108 LEU CD1 HD11 sing N N 109 LEU CD1 HD12 sing N N 110 LEU CD1 HD13 sing N N 111 LEU CD2 HD21 sing N N 112 LEU CD2 HD22 sing N N 113 LEU CD2 HD23 sing N N 114 LEU OXT HXT sing N N 115 LYS N CA sing N N 116 LYS N H sing N N 117 LYS N H2 sing N N 118 LYS CA C sing N N 119 LYS CA CB sing N N 120 LYS CA HA sing N N 121 LYS C O doub N N 122 LYS C OXT sing N N 123 LYS CB CG sing N N 124 LYS CB HB2 sing N N 125 LYS CB HB3 sing N N 126 LYS CG CD sing N N 127 LYS CG HG2 sing N N 128 LYS CG HG3 sing N N 129 LYS CD CE sing N N 130 LYS CD HD2 sing N N 131 LYS CD HD3 sing N N 132 LYS CE NZ sing N N 133 LYS CE HE2 sing N N 134 LYS CE HE3 sing N N 135 LYS NZ HZ1 sing N N 136 LYS NZ HZ2 sing N N 137 LYS NZ HZ3 sing N N 138 LYS OXT HXT sing N N 139 MET N CA sing N N 140 MET N H sing N N 141 MET N H2 sing N N 142 MET CA C sing N N 143 MET CA CB sing N N 144 MET CA HA sing N N 145 MET C O doub N N 146 MET C OXT sing N N 147 MET CB CG sing N N 148 MET CB HB2 sing N N 149 MET CB HB3 sing N N 150 MET CG SD sing N N 151 MET CG HG2 sing N N 152 MET CG HG3 sing N N 153 MET SD CE sing N N 154 MET CE HE1 sing N N 155 MET CE HE2 sing N N 156 MET CE HE3 sing N N 157 MET OXT HXT sing N N 158 PHE N CA sing N N 159 PHE N H sing N N 160 PHE N H2 sing N N 161 PHE CA C sing N N 162 PHE CA CB sing N N 163 PHE CA HA sing N N 164 PHE C O doub N N 165 PHE C OXT sing N N 166 PHE CB CG sing N N 167 PHE CB HB2 sing N N 168 PHE CB HB3 sing N N 169 PHE CG CD1 doub Y N 170 PHE CG CD2 sing Y N 171 PHE CD1 CE1 sing Y N 172 PHE CD1 HD1 sing N N 173 PHE CD2 CE2 doub Y N 174 PHE CD2 HD2 sing N N 175 PHE CE1 CZ doub Y N 176 PHE CE1 HE1 sing N N 177 PHE CE2 CZ sing Y N 178 PHE CE2 HE2 sing N N 179 PHE CZ HZ sing N N 180 PHE OXT HXT sing N N 181 PRO N CA sing N N 182 PRO N CD sing N N 183 PRO N H sing N N 184 PRO CA C sing N N 185 PRO CA CB sing N N 186 PRO CA HA sing N N 187 PRO C O doub N N 188 PRO C OXT sing N N 189 PRO CB CG sing N N 190 PRO CB HB2 sing N N 191 PRO CB HB3 sing N N 192 PRO CG CD sing N N 193 PRO CG HG2 sing N N 194 PRO CG HG3 sing N N 195 PRO CD HD2 sing N N 196 PRO CD HD3 sing N N 197 PRO OXT HXT sing N N 198 SER N CA sing N N 199 SER N H sing N N 200 SER N H2 sing N N 201 SER CA C sing N N 202 SER CA CB sing N N 203 SER CA HA sing N N 204 SER C O doub N N 205 SER C OXT sing N N 206 SER CB OG sing N N 207 SER CB HB2 sing N N 208 SER CB HB3 sing N N 209 SER OG HG sing N N 210 SER OXT HXT sing N N 211 THR N CA sing N N 212 THR N H sing N N 213 THR N H2 sing N N 214 THR CA C sing N N 215 THR CA CB sing N N 216 THR CA HA sing N N 217 THR C O doub N N 218 THR C OXT sing N N 219 THR CB OG1 sing N N 220 THR CB CG2 sing N N 221 THR CB HB sing N N 222 THR OG1 HG1 sing N N 223 THR CG2 HG21 sing N N 224 THR CG2 HG22 sing N N 225 THR CG2 HG23 sing N N 226 THR OXT HXT sing N N 227 TRP N CA sing N N 228 TRP N H sing N N 229 TRP N H2 sing N N 230 TRP CA C sing N N 231 TRP CA CB sing N N 232 TRP CA HA sing N N 233 TRP C O doub N N 234 TRP C OXT sing N N 235 TRP CB CG sing N N 236 TRP CB HB2 sing N N 237 TRP CB HB3 sing N N 238 TRP CG CD1 doub Y N 239 TRP CG CD2 sing Y N 240 TRP CD1 NE1 sing Y N 241 TRP CD1 HD1 sing N N 242 TRP CD2 CE2 doub Y N 243 TRP CD2 CE3 sing Y N 244 TRP NE1 CE2 sing Y N 245 TRP NE1 HE1 sing N N 246 TRP CE2 CZ2 sing Y N 247 TRP CE3 CZ3 doub Y N 248 TRP CE3 HE3 sing N N 249 TRP CZ2 CH2 doub Y N 250 TRP CZ2 HZ2 sing N N 251 TRP CZ3 CH2 sing Y N 252 TRP CZ3 HZ3 sing N N 253 TRP CH2 HH2 sing N N 254 TRP OXT HXT sing N N 255 TYR N CA sing N N 256 TYR N H sing N N 257 TYR N H2 sing N N 258 TYR CA C sing N N 259 TYR CA CB sing N N 260 TYR CA HA sing N N 261 TYR C O doub N N 262 TYR C OXT sing N N 263 TYR CB CG sing N N 264 TYR CB HB2 sing N N 265 TYR CB HB3 sing N N 266 TYR CG CD1 doub Y N 267 TYR CG CD2 sing Y N 268 TYR CD1 CE1 sing Y N 269 TYR CD1 HD1 sing N N 270 TYR CD2 CE2 doub Y N 271 TYR CD2 HD2 sing N N 272 TYR CE1 CZ doub Y N 273 TYR CE1 HE1 sing N N 274 TYR CE2 CZ sing Y N 275 TYR CE2 HE2 sing N N 276 TYR CZ OH sing N N 277 TYR OH HH sing N N 278 TYR OXT HXT sing N N 279 VAL N CA sing N N 280 VAL N H sing N N 281 VAL N H2 sing N N 282 VAL CA C sing N N 283 VAL CA CB sing N N 284 VAL CA HA sing N N 285 VAL C O doub N N 286 VAL C OXT sing N N 287 VAL CB CG1 sing N N 288 VAL CB CG2 sing N N 289 VAL CB HB sing N N 290 VAL CG1 HG11 sing N N 291 VAL CG1 HG12 sing N N 292 VAL CG1 HG13 sing N N 293 VAL CG2 HG21 sing N N 294 VAL CG2 HG22 sing N N 295 VAL CG2 HG23 sing N N 296 VAL OXT HXT sing N N 297 # _em_ctf_correction.id 1 _em_ctf_correction.details 'phase flipping of entire images' _em_ctf_correction.type . # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.avg_electron_dose_per_image . _em_image_recording.details ? _em_image_recording.id 1 _em_image_recording.film_or_detector_model 'KODAK SO-163 FILM' _em_image_recording.imaging_id 1 _em_image_recording.detector_mode ? _em_image_recording.average_exposure_time ? _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_software.id 1 _em_software.name IHRSR _em_software.version ? _em_software.category RECONSTRUCTION _em_software.details ? _em_software.image_processing_id 1 # _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.concentration ? _em_specimen.vitrification_applied YES _em_specimen.staining_applied NO _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.details ? # _atom_sites.entry_id 2HI5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ #