data_2HI6 # _entry.id 2HI6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HI6 pdb_00002hi6 10.2210/pdb2hi6/pdb RCSB RCSB038374 ? ? WWPDB D_1000038374 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-29 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HI6 _pdbx_database_status.recvd_initial_deposition_date 2006-06-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id GR101 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Atreya, H.' 2 'Xu, D.' 3 'Sukumaran, D.K.' 4 'Chen, C.X.' 5 'Janjua, H.' 6 'Cunningham, K.' 7 'Ma, L.-C.' 8 'Xiao, R.' 9 'Liu, J.' 10 'Baran, M.' 11 'Swapna, G.V.T.' 12 'Acton, T.B.' 13 'Rost, B.' 14 'Montelione, G.T.' 15 'Szyperski, T.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title 'Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101 (CASP Target)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Atreya, H.' 2 ? primary 'Xu, D.' 3 ? primary 'Sukumaran, D.K.' 4 ? primary 'Chen, C.X.' 5 ? primary 'Janjua, H.' 6 ? primary 'Cunningham, K.' 7 ? primary 'Ma, L.-C.' 8 ? primary 'Xiao, R.' 9 ? primary 'Liu, J.' 10 ? primary 'Baran, M.' 11 ? primary 'Swapna, G.V.T.' 12 ? primary 'Acton, T.B.' 13 ? primary 'Rost, B.' 14 ? primary 'Montelione, G.T.' 15 ? primary 'Szyperski, T.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UPF0107 protein AF0055' _entity.formula_weight 15378.731 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPK AIINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPK AIINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GR101 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 PHE n 1 5 ALA n 1 6 CYS n 1 7 ARG n 1 8 ALA n 1 9 ILE n 1 10 THR n 1 11 ARG n 1 12 GLY n 1 13 ARG n 1 14 ALA n 1 15 GLU n 1 16 GLY n 1 17 GLU n 1 18 ALA n 1 19 LEU n 1 20 VAL n 1 21 THR n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 ILE n 1 26 SER n 1 27 PHE n 1 28 LEU n 1 29 GLY n 1 30 GLY n 1 31 ILE n 1 32 ASP n 1 33 LYS n 1 34 GLU n 1 35 THR n 1 36 GLY n 1 37 ILE n 1 38 VAL n 1 39 LYS n 1 40 GLU n 1 41 ASP n 1 42 CYS n 1 43 GLU n 1 44 ILE n 1 45 LYS n 1 46 GLY n 1 47 GLU n 1 48 SER n 1 49 VAL n 1 50 ALA n 1 51 GLY n 1 52 ARG n 1 53 ILE n 1 54 LEU n 1 55 VAL n 1 56 PHE n 1 57 PRO n 1 58 GLY n 1 59 GLY n 1 60 LYS n 1 61 GLY n 1 62 SER n 1 63 THR n 1 64 VAL n 1 65 GLY n 1 66 SER n 1 67 TYR n 1 68 VAL n 1 69 LEU n 1 70 LEU n 1 71 ASN n 1 72 LEU n 1 73 ARG n 1 74 LYS n 1 75 ASN n 1 76 GLY n 1 77 VAL n 1 78 ALA n 1 79 PRO n 1 80 LYS n 1 81 ALA n 1 82 ILE n 1 83 ILE n 1 84 ASN n 1 85 LYS n 1 86 LYS n 1 87 THR n 1 88 GLU n 1 89 THR n 1 90 ILE n 1 91 ILE n 1 92 ALA n 1 93 VAL n 1 94 GLY n 1 95 ALA n 1 96 ALA n 1 97 MET n 1 98 ALA n 1 99 GLU n 1 100 ILE n 1 101 PRO n 1 102 LEU n 1 103 VAL n 1 104 GLU n 1 105 VAL n 1 106 ARG n 1 107 ASP n 1 108 GLU n 1 109 LYS n 1 110 PHE n 1 111 PHE n 1 112 GLU n 1 113 ALA n 1 114 VAL n 1 115 LYS n 1 116 THR n 1 117 GLY n 1 118 ASP n 1 119 ARG n 1 120 VAL n 1 121 VAL n 1 122 VAL n 1 123 ASN n 1 124 ALA n 1 125 ASP n 1 126 GLU n 1 127 GLY n 1 128 TYR n 1 129 VAL n 1 130 GLU n 1 131 LEU n 1 132 ILE n 1 133 GLU n 1 134 LEU n 1 135 GLU n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n 1 141 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Archaeoglobus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2234 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name GR101-21.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 PHE 4 3 3 PHE PHE A . n A 1 5 ALA 5 4 4 ALA ALA A . n A 1 6 CYS 6 5 5 CYS CYS A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 ALA 8 7 7 ALA ALA A . n A 1 9 ILE 9 8 8 ILE ILE A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 ARG 11 10 10 ARG ARG A . n A 1 12 GLY 12 11 11 GLY GLY A . n A 1 13 ARG 13 12 12 ARG ARG A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 TYR 24 23 23 TYR TYR A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ASP 32 31 31 ASP ASP A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 CYS 42 41 41 CYS CYS A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 ILE 44 43 43 ILE ILE A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 SER 48 47 47 SER SER A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 ARG 52 51 51 ARG ARG A . n A 1 53 ILE 53 52 52 ILE ILE A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 GLY 58 57 57 GLY GLY A . n A 1 59 GLY 59 58 58 GLY GLY A . n A 1 60 LYS 60 59 59 LYS LYS A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 SER 62 61 61 SER SER A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 SER 66 65 65 SER SER A . n A 1 67 TYR 67 66 66 TYR TYR A . n A 1 68 VAL 68 67 67 VAL VAL A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 GLY 76 75 75 GLY GLY A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 ALA 78 77 77 ALA ALA A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 ILE 82 81 81 ILE ILE A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 ASN 84 83 83 ASN ASN A . n A 1 85 LYS 85 84 84 LYS LYS A . n A 1 86 LYS 86 85 85 LYS LYS A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 THR 89 88 88 THR THR A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 GLY 94 93 93 GLY GLY A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 MET 97 96 96 MET MET A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 LEU 102 101 101 LEU LEU A . n A 1 103 VAL 103 102 102 VAL VAL A . n A 1 104 GLU 104 103 103 GLU GLU A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 ASP 107 106 106 ASP ASP A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 PHE 110 109 109 PHE PHE A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 ALA 113 112 112 ALA ALA A . n A 1 114 VAL 114 113 113 VAL VAL A . n A 1 115 LYS 115 114 114 LYS LYS A . n A 1 116 THR 116 115 115 THR THR A . n A 1 117 GLY 117 116 116 GLY GLY A . n A 1 118 ASP 118 117 117 ASP ASP A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 VAL 122 121 121 VAL VAL A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 GLU 126 125 125 GLU GLU A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 TYR 128 127 127 TYR TYR A . n A 1 129 VAL 129 128 128 VAL VAL A . n A 1 130 GLU 130 129 129 GLU GLU A . n A 1 131 LEU 131 130 130 LEU LEU A . n A 1 132 ILE 132 131 131 ILE ILE A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 LEU 134 133 ? ? ? A . n A 1 135 GLU 135 134 ? ? ? A . n A 1 136 HIS 136 135 ? ? ? A . n A 1 137 HIS 137 136 ? ? ? A . n A 1 138 HIS 138 137 ? ? ? A . n A 1 139 HIS 139 138 ? ? ? A . n A 1 140 HIS 140 139 ? ? ? A . n A 1 141 HIS 141 140 ? ? ? A . n # _cell.entry_id 2HI6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HI6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2HI6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2HI6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2HI6 _struct.title 'Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HI6 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;UPF0107 protein AF_0055GFT, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y055_ARCFU _struct_ref.pdbx_db_accession O30181 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HI6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O30181 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HI6 MET A 1 ? UNP O30181 ? ? 'initiating methionine' 0 1 1 2HI6 VAL A 2 ? UNP O30181 ? ? 'cloning artifact' 1 2 1 2HI6 LEU A 134 ? UNP O30181 ? ? 'cloning artifact' 133 3 1 2HI6 GLU A 135 ? UNP O30181 ? ? 'cloning artifact' 134 4 1 2HI6 HIS A 136 ? UNP O30181 ? ? 'expression tag' 135 5 1 2HI6 HIS A 137 ? UNP O30181 ? ? 'expression tag' 136 6 1 2HI6 HIS A 138 ? UNP O30181 ? ? 'expression tag' 137 7 1 2HI6 HIS A 139 ? UNP O30181 ? ? 'expression tag' 138 8 1 2HI6 HIS A 140 ? UNP O30181 ? ? 'expression tag' 139 9 1 2HI6 HIS A 141 ? UNP O30181 ? ? 'expression tag' 140 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 67 ? GLY A 76 ? TYR A 66 GLY A 75 1 ? 10 HELX_P HELX_P2 2 GLU A 88 ? GLU A 99 ? GLU A 87 GLU A 98 1 ? 12 HELX_P HELX_P3 3 GLU A 108 ? VAL A 114 ? GLU A 107 VAL A 113 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 3 ? ALA A 5 ? LYS A 2 ALA A 4 A 2 TYR A 128 ? ILE A 132 ? TYR A 127 ILE A 131 A 3 ARG A 119 ? ASN A 123 ? ARG A 118 ASN A 122 A 4 ARG A 13 ? VAL A 20 ? ARG A 12 VAL A 19 A 5 ILE A 53 ? PHE A 56 ? ILE A 52 PHE A 55 A 6 ALA A 81 ? ASN A 84 ? ALA A 80 ASN A 83 A 7 LEU A 102 ? GLU A 104 ? LEU A 101 GLU A 103 A 8 ARG A 7 ? ALA A 8 ? ARG A 6 ALA A 7 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 4 ? N PHE A 3 O VAL A 129 ? O VAL A 128 A 2 3 O GLU A 130 ? O GLU A 129 N VAL A 121 ? N VAL A 120 A 3 4 O VAL A 122 ? O VAL A 121 N ALA A 14 ? N ALA A 13 A 4 5 N LEU A 19 ? N LEU A 18 O ILE A 53 ? O ILE A 52 A 5 6 N LEU A 54 ? N LEU A 53 O ALA A 81 ? O ALA A 80 A 6 7 N ASN A 84 ? N ASN A 83 O VAL A 103 ? O VAL A 102 A 7 8 O GLU A 104 ? O GLU A 103 N ARG A 7 ? N ARG A 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 32 ? ? OE1 A GLU 33 ? ? 1.57 2 2 HB A THR 20 ? ? HB3 A PHE 55 ? ? 1.26 3 6 OD1 A ASP 40 ? ? H A CYS 41 ? ? 1.57 4 7 HZ2 A LYS 114 ? ? OD2 A ASP 117 ? ? 1.59 5 8 HZ2 A LYS 21 ? ? OE2 A GLU 107 ? ? 1.60 6 9 HB3 A ASP 40 ? ? HB2 A LYS 44 ? ? 1.29 7 10 HH21 A ARG 12 ? ? OE2 A GLU 129 ? ? 1.59 8 11 HZ3 A LYS 21 ? ? OE2 A GLU 111 ? ? 1.56 9 11 HZ2 A LYS 84 ? ? OE1 A GLU 107 ? ? 1.58 10 11 O A GLY 64 ? ? HG A SER 65 ? ? 1.60 11 12 HD21 A LEU 18 ? ? HG21 A ILE 43 ? ? 1.31 12 13 HD21 A ASN 122 ? ? OE1 A GLU 125 ? ? 1.58 13 14 HH21 A ARG 118 ? ? HG13 A ILE 131 ? ? 1.30 14 14 HZ3 A LYS 2 ? ? OE1 A GLU 129 ? ? 1.59 15 16 HH21 A ARG 118 ? ? HG13 A ILE 131 ? ? 1.32 16 17 HG A CYS 5 ? ? HG21 A VAL 102 ? ? 1.31 17 17 OD2 A ASP 31 ? ? HZ3 A LYS 38 ? ? 1.55 18 17 HZ2 A LYS 108 ? ? OE1 A GLU 111 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 21 ? ? 68.54 -61.07 2 1 CYS A 41 ? ? -161.27 -56.23 3 1 GLU A 42 ? ? -173.29 -51.73 4 1 ILE A 43 ? ? -92.05 44.57 5 1 PRO A 100 ? ? -40.04 109.70 6 2 THR A 9 ? ? -109.57 -165.00 7 2 PHE A 26 ? ? -85.48 31.26 8 2 CYS A 41 ? ? 174.55 -178.22 9 2 ALA A 49 ? ? -68.25 88.04 10 2 SER A 65 ? ? 60.06 -154.56 11 2 TYR A 66 ? ? 72.35 -56.48 12 2 GLU A 98 ? ? 71.71 59.89 13 2 PRO A 100 ? ? -38.29 107.56 14 3 CYS A 41 ? ? -172.81 -73.65 15 3 GLU A 42 ? ? -156.58 -51.18 16 3 TYR A 66 ? ? 75.58 -43.76 17 4 THR A 9 ? ? -125.29 -164.25 18 4 SER A 65 ? ? 173.13 -77.10 19 5 LYS A 2 ? ? 64.34 77.84 20 5 CYS A 41 ? ? -178.68 -49.63 21 5 GLU A 42 ? ? 176.20 -45.98 22 5 VAL A 48 ? ? -74.47 -76.52 23 5 ALA A 49 ? ? 46.30 81.42 24 5 THR A 62 ? ? 53.89 16.91 25 5 TYR A 66 ? ? -156.24 -21.61 26 6 CYS A 41 ? ? -166.87 -41.20 27 6 ALA A 49 ? ? -67.22 92.51 28 6 THR A 62 ? ? -83.70 42.86 29 6 SER A 65 ? ? 52.51 -161.03 30 6 TYR A 66 ? ? 69.32 -31.95 31 6 PRO A 100 ? ? -47.89 105.43 32 6 THR A 115 ? ? -67.87 94.62 33 7 LYS A 2 ? ? 63.74 96.86 34 7 CYS A 41 ? ? -174.22 -170.64 35 7 GLU A 98 ? ? 65.91 72.54 36 7 PRO A 100 ? ? -39.30 110.04 37 8 THR A 9 ? ? -113.13 -164.99 38 8 SER A 25 ? ? 68.57 -26.81 39 8 PHE A 26 ? ? 75.36 -31.25 40 8 CYS A 41 ? ? -170.80 39.04 41 8 GLU A 42 ? ? 75.63 -29.94 42 8 ALA A 49 ? ? -64.87 94.62 43 8 LYS A 59 ? ? 174.64 -70.59 44 8 SER A 61 ? ? 70.24 -165.52 45 8 THR A 62 ? ? -102.00 58.12 46 8 SER A 65 ? ? 56.43 12.76 47 8 THR A 86 ? ? 72.48 124.03 48 8 PRO A 100 ? ? -35.30 112.56 49 8 THR A 115 ? ? -58.40 107.49 50 8 ASP A 117 ? ? -101.09 -166.96 51 9 SER A 25 ? ? 51.80 -154.54 52 9 PHE A 26 ? ? -143.64 18.25 53 9 CYS A 41 ? ? -144.82 -23.14 54 9 GLU A 42 ? ? -133.86 -47.77 55 9 ALA A 49 ? ? -69.42 89.51 56 9 SER A 61 ? ? 63.99 -177.06 57 9 TYR A 66 ? ? 75.25 -35.46 58 10 ILE A 8 ? ? -90.75 -66.56 59 10 LEU A 27 ? ? -165.83 -162.57 60 10 CYS A 41 ? ? -144.55 28.04 61 10 GLU A 42 ? ? 70.26 -69.12 62 10 ALA A 49 ? ? -66.13 92.16 63 11 PHE A 26 ? ? -56.29 -70.49 64 11 LEU A 27 ? ? 59.28 -85.42 65 11 ILE A 43 ? ? -105.38 43.54 66 11 ALA A 49 ? ? -66.31 95.03 67 11 THR A 62 ? ? -84.49 49.14 68 11 SER A 65 ? ? 60.20 -152.47 69 11 TYR A 66 ? ? 76.07 -42.90 70 12 CYS A 41 ? ? -155.30 -32.47 71 12 LYS A 59 ? ? 55.04 90.71 72 12 SER A 61 ? ? 65.24 -172.26 73 12 SER A 65 ? ? -140.87 -70.50 74 13 SER A 25 ? ? 48.94 23.25 75 13 CYS A 41 ? ? -160.78 35.17 76 13 GLU A 42 ? ? 72.38 -51.64 77 13 ILE A 43 ? ? -88.55 42.36 78 13 LYS A 59 ? ? -173.54 -64.58 79 13 THR A 62 ? ? -154.77 -40.13 80 13 SER A 65 ? ? -90.09 -73.22 81 13 PRO A 100 ? ? -49.96 100.41 82 13 ARG A 105 ? ? -84.16 35.85 83 14 LYS A 21 ? ? -67.77 -72.20 84 14 GLU A 22 ? ? 51.15 -163.52 85 14 TYR A 23 ? ? -158.59 44.49 86 14 LEU A 27 ? ? -124.97 -77.49 87 14 GLU A 42 ? ? 175.52 -62.25 88 14 ILE A 43 ? ? -114.79 71.02 89 14 ALA A 49 ? ? -65.32 94.76 90 14 TYR A 66 ? ? 74.11 -52.80 91 14 PRO A 100 ? ? -48.48 96.51 92 15 ILE A 43 ? ? -108.19 53.63 93 15 ALA A 49 ? ? -69.23 89.15 94 15 LYS A 59 ? ? 69.10 -85.47 95 15 SER A 61 ? ? -151.72 53.85 96 15 THR A 62 ? ? 73.57 -19.38 97 15 VAL A 63 ? ? -82.52 36.66 98 15 TYR A 66 ? ? 74.37 -44.57 99 16 LYS A 2 ? ? 69.03 93.21 100 16 PHE A 26 ? ? 72.09 -10.12 101 16 LEU A 27 ? ? -94.94 33.03 102 16 CYS A 41 ? ? -172.08 26.04 103 16 GLU A 42 ? ? 69.25 -39.95 104 16 ALA A 49 ? ? -68.52 90.64 105 16 SER A 65 ? ? 74.46 -33.31 106 17 ILE A 8 ? ? -101.51 -60.66 107 17 LEU A 27 ? ? -134.86 -68.08 108 17 CYS A 41 ? ? 173.56 50.50 109 17 GLU A 42 ? ? 72.42 -47.86 110 17 ALA A 49 ? ? -69.32 91.62 111 17 SER A 65 ? ? 66.43 -165.51 112 17 TYR A 66 ? ? 72.24 -30.07 113 17 PRO A 100 ? ? -48.33 100.23 114 17 GLU A 125 ? ? -147.14 -43.17 115 18 THR A 9 ? ? -111.95 -165.73 116 18 LYS A 21 ? ? -92.29 -83.20 117 18 GLU A 22 ? ? 44.84 -163.80 118 18 PHE A 26 ? ? -79.91 39.80 119 18 ILE A 43 ? ? -116.30 51.42 120 18 SER A 61 ? ? -51.12 104.32 121 18 PRO A 100 ? ? -47.53 98.45 122 18 THR A 115 ? ? -68.20 94.35 123 19 GLU A 42 ? ? -172.36 -29.92 124 19 ALA A 49 ? ? -68.84 87.93 125 19 LYS A 59 ? ? 69.33 127.77 126 19 THR A 62 ? ? -76.73 37.29 127 19 VAL A 67 ? ? 72.99 -60.88 128 20 SER A 25 ? ? -87.38 36.36 129 20 PHE A 26 ? ? 63.88 -81.89 130 20 LEU A 27 ? ? 58.41 -85.40 131 20 CYS A 41 ? ? -141.32 -37.93 132 20 GLU A 42 ? ? -141.02 -62.47 133 20 ALA A 49 ? ? -64.86 96.54 134 20 LYS A 59 ? ? 70.62 166.04 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 2HI6 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HI6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;5-5.5mM CaCl2, 100mM NaCl, 20mM NH4OAc, 10mM DTT, 0.02% NaN3, pH 5.5, 5% D2O, 95% H2O U-15N,13C ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'SIMULTANEOUS HETERONUCLEAR RESOLVED [1H,1H]-NOESY' 1 2 1 'GFT (4,3)D HNNCABCA' 1 3 1 'GFT (4,3)D CABCA(CO)NHN' 1 4 1 'GFT (4,3)D HABCAB(CO)NHN' 1 5 1 'GFT (4,3)D HCCH' 1 # _pdbx_nmr_refine.entry_id 2HI6 _pdbx_nmr_refine.method 'simulated annealing molecular dynamics torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1c ? 1 processing NMRPipe 2.3 'Delaglio, F' 2 'data analysis' AutoAssign 1.15.1 'Moseley, H.' 3 'data analysis' AutoStructure 2.0 'HUANG, Y.J.' 4 'structure solution' CYANA 2.1 'GUNTERT, P.' 5 refinement CNS 1.1 'Brunger, A.T.' 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A LEU 133 ? A LEU 134 3 1 Y 1 A GLU 134 ? A GLU 135 4 1 Y 1 A HIS 135 ? A HIS 136 5 1 Y 1 A HIS 136 ? A HIS 137 6 1 Y 1 A HIS 137 ? A HIS 138 7 1 Y 1 A HIS 138 ? A HIS 139 8 1 Y 1 A HIS 139 ? A HIS 140 9 1 Y 1 A HIS 140 ? A HIS 141 10 2 Y 1 A MET 0 ? A MET 1 11 2 Y 1 A LEU 133 ? A LEU 134 12 2 Y 1 A GLU 134 ? A GLU 135 13 2 Y 1 A HIS 135 ? A HIS 136 14 2 Y 1 A HIS 136 ? A HIS 137 15 2 Y 1 A HIS 137 ? A HIS 138 16 2 Y 1 A HIS 138 ? A HIS 139 17 2 Y 1 A HIS 139 ? A HIS 140 18 2 Y 1 A HIS 140 ? A HIS 141 19 3 Y 1 A MET 0 ? A MET 1 20 3 Y 1 A LEU 133 ? A LEU 134 21 3 Y 1 A GLU 134 ? A GLU 135 22 3 Y 1 A HIS 135 ? A HIS 136 23 3 Y 1 A HIS 136 ? A HIS 137 24 3 Y 1 A HIS 137 ? A HIS 138 25 3 Y 1 A HIS 138 ? A HIS 139 26 3 Y 1 A HIS 139 ? A HIS 140 27 3 Y 1 A HIS 140 ? A HIS 141 28 4 Y 1 A MET 0 ? A MET 1 29 4 Y 1 A LEU 133 ? A LEU 134 30 4 Y 1 A GLU 134 ? A GLU 135 31 4 Y 1 A HIS 135 ? A HIS 136 32 4 Y 1 A HIS 136 ? A HIS 137 33 4 Y 1 A HIS 137 ? A HIS 138 34 4 Y 1 A HIS 138 ? A HIS 139 35 4 Y 1 A HIS 139 ? A HIS 140 36 4 Y 1 A HIS 140 ? A HIS 141 37 5 Y 1 A MET 0 ? A MET 1 38 5 Y 1 A LEU 133 ? A LEU 134 39 5 Y 1 A GLU 134 ? A GLU 135 40 5 Y 1 A HIS 135 ? A HIS 136 41 5 Y 1 A HIS 136 ? A HIS 137 42 5 Y 1 A HIS 137 ? A HIS 138 43 5 Y 1 A HIS 138 ? A HIS 139 44 5 Y 1 A HIS 139 ? A HIS 140 45 5 Y 1 A HIS 140 ? A HIS 141 46 6 Y 1 A MET 0 ? A MET 1 47 6 Y 1 A LEU 133 ? A LEU 134 48 6 Y 1 A GLU 134 ? A GLU 135 49 6 Y 1 A HIS 135 ? A HIS 136 50 6 Y 1 A HIS 136 ? A HIS 137 51 6 Y 1 A HIS 137 ? A HIS 138 52 6 Y 1 A HIS 138 ? A HIS 139 53 6 Y 1 A HIS 139 ? A HIS 140 54 6 Y 1 A HIS 140 ? A HIS 141 55 7 Y 1 A MET 0 ? A MET 1 56 7 Y 1 A LEU 133 ? A LEU 134 57 7 Y 1 A GLU 134 ? A GLU 135 58 7 Y 1 A HIS 135 ? A HIS 136 59 7 Y 1 A HIS 136 ? A HIS 137 60 7 Y 1 A HIS 137 ? A HIS 138 61 7 Y 1 A HIS 138 ? A HIS 139 62 7 Y 1 A HIS 139 ? A HIS 140 63 7 Y 1 A HIS 140 ? A HIS 141 64 8 Y 1 A MET 0 ? A MET 1 65 8 Y 1 A LEU 133 ? A LEU 134 66 8 Y 1 A GLU 134 ? A GLU 135 67 8 Y 1 A HIS 135 ? A HIS 136 68 8 Y 1 A HIS 136 ? A HIS 137 69 8 Y 1 A HIS 137 ? A HIS 138 70 8 Y 1 A HIS 138 ? A HIS 139 71 8 Y 1 A HIS 139 ? A HIS 140 72 8 Y 1 A HIS 140 ? A HIS 141 73 9 Y 1 A MET 0 ? A MET 1 74 9 Y 1 A LEU 133 ? A LEU 134 75 9 Y 1 A GLU 134 ? A GLU 135 76 9 Y 1 A HIS 135 ? A HIS 136 77 9 Y 1 A HIS 136 ? A HIS 137 78 9 Y 1 A HIS 137 ? A HIS 138 79 9 Y 1 A HIS 138 ? A HIS 139 80 9 Y 1 A HIS 139 ? A HIS 140 81 9 Y 1 A HIS 140 ? A HIS 141 82 10 Y 1 A MET 0 ? A MET 1 83 10 Y 1 A LEU 133 ? A LEU 134 84 10 Y 1 A GLU 134 ? A GLU 135 85 10 Y 1 A HIS 135 ? A HIS 136 86 10 Y 1 A HIS 136 ? A HIS 137 87 10 Y 1 A HIS 137 ? A HIS 138 88 10 Y 1 A HIS 138 ? A HIS 139 89 10 Y 1 A HIS 139 ? A HIS 140 90 10 Y 1 A HIS 140 ? A HIS 141 91 11 Y 1 A MET 0 ? A MET 1 92 11 Y 1 A LEU 133 ? A LEU 134 93 11 Y 1 A GLU 134 ? A GLU 135 94 11 Y 1 A HIS 135 ? A HIS 136 95 11 Y 1 A HIS 136 ? A HIS 137 96 11 Y 1 A HIS 137 ? A HIS 138 97 11 Y 1 A HIS 138 ? A HIS 139 98 11 Y 1 A HIS 139 ? A HIS 140 99 11 Y 1 A HIS 140 ? A HIS 141 100 12 Y 1 A MET 0 ? A MET 1 101 12 Y 1 A LEU 133 ? A LEU 134 102 12 Y 1 A GLU 134 ? A GLU 135 103 12 Y 1 A HIS 135 ? A HIS 136 104 12 Y 1 A HIS 136 ? A HIS 137 105 12 Y 1 A HIS 137 ? A HIS 138 106 12 Y 1 A HIS 138 ? A HIS 139 107 12 Y 1 A HIS 139 ? A HIS 140 108 12 Y 1 A HIS 140 ? A HIS 141 109 13 Y 1 A MET 0 ? A MET 1 110 13 Y 1 A LEU 133 ? A LEU 134 111 13 Y 1 A GLU 134 ? A GLU 135 112 13 Y 1 A HIS 135 ? A HIS 136 113 13 Y 1 A HIS 136 ? A HIS 137 114 13 Y 1 A HIS 137 ? A HIS 138 115 13 Y 1 A HIS 138 ? A HIS 139 116 13 Y 1 A HIS 139 ? A HIS 140 117 13 Y 1 A HIS 140 ? A HIS 141 118 14 Y 1 A MET 0 ? A MET 1 119 14 Y 1 A LEU 133 ? A LEU 134 120 14 Y 1 A GLU 134 ? A GLU 135 121 14 Y 1 A HIS 135 ? A HIS 136 122 14 Y 1 A HIS 136 ? A HIS 137 123 14 Y 1 A HIS 137 ? A HIS 138 124 14 Y 1 A HIS 138 ? A HIS 139 125 14 Y 1 A HIS 139 ? A HIS 140 126 14 Y 1 A HIS 140 ? A HIS 141 127 15 Y 1 A MET 0 ? A MET 1 128 15 Y 1 A LEU 133 ? A LEU 134 129 15 Y 1 A GLU 134 ? A GLU 135 130 15 Y 1 A HIS 135 ? A HIS 136 131 15 Y 1 A HIS 136 ? A HIS 137 132 15 Y 1 A HIS 137 ? A HIS 138 133 15 Y 1 A HIS 138 ? A HIS 139 134 15 Y 1 A HIS 139 ? A HIS 140 135 15 Y 1 A HIS 140 ? A HIS 141 136 16 Y 1 A MET 0 ? A MET 1 137 16 Y 1 A LEU 133 ? A LEU 134 138 16 Y 1 A GLU 134 ? A GLU 135 139 16 Y 1 A HIS 135 ? A HIS 136 140 16 Y 1 A HIS 136 ? A HIS 137 141 16 Y 1 A HIS 137 ? A HIS 138 142 16 Y 1 A HIS 138 ? A HIS 139 143 16 Y 1 A HIS 139 ? A HIS 140 144 16 Y 1 A HIS 140 ? A HIS 141 145 17 Y 1 A MET 0 ? A MET 1 146 17 Y 1 A LEU 133 ? A LEU 134 147 17 Y 1 A GLU 134 ? A GLU 135 148 17 Y 1 A HIS 135 ? A HIS 136 149 17 Y 1 A HIS 136 ? A HIS 137 150 17 Y 1 A HIS 137 ? A HIS 138 151 17 Y 1 A HIS 138 ? A HIS 139 152 17 Y 1 A HIS 139 ? A HIS 140 153 17 Y 1 A HIS 140 ? A HIS 141 154 18 Y 1 A MET 0 ? A MET 1 155 18 Y 1 A LEU 133 ? A LEU 134 156 18 Y 1 A GLU 134 ? A GLU 135 157 18 Y 1 A HIS 135 ? A HIS 136 158 18 Y 1 A HIS 136 ? A HIS 137 159 18 Y 1 A HIS 137 ? A HIS 138 160 18 Y 1 A HIS 138 ? A HIS 139 161 18 Y 1 A HIS 139 ? A HIS 140 162 18 Y 1 A HIS 140 ? A HIS 141 163 19 Y 1 A MET 0 ? A MET 1 164 19 Y 1 A LEU 133 ? A LEU 134 165 19 Y 1 A GLU 134 ? A GLU 135 166 19 Y 1 A HIS 135 ? A HIS 136 167 19 Y 1 A HIS 136 ? A HIS 137 168 19 Y 1 A HIS 137 ? A HIS 138 169 19 Y 1 A HIS 138 ? A HIS 139 170 19 Y 1 A HIS 139 ? A HIS 140 171 19 Y 1 A HIS 140 ? A HIS 141 172 20 Y 1 A MET 0 ? A MET 1 173 20 Y 1 A LEU 133 ? A LEU 134 174 20 Y 1 A GLU 134 ? A GLU 135 175 20 Y 1 A HIS 135 ? A HIS 136 176 20 Y 1 A HIS 136 ? A HIS 137 177 20 Y 1 A HIS 137 ? A HIS 138 178 20 Y 1 A HIS 138 ? A HIS 139 179 20 Y 1 A HIS 139 ? A HIS 140 180 20 Y 1 A HIS 140 ? A HIS 141 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 750 ? 2 INOVA Varian 600 ? # _atom_sites.entry_id 2HI6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #